KEGG   Xanthomonas alfalfae: XACM_2646Help
Entry
XACM_2646         CDS       T01616                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
xax  Xanthomonas alfalfae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:xax00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XACM_2646 (tpiA)
   01230 Biosynthesis of amino acids
    XACM_2646 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XACM_2646 (tpiA)
   00051 Fructose and mannose metabolism
    XACM_2646 (tpiA)
   00562 Inositol phosphate metabolism
    XACM_2646 (tpiA)
Enzymes [BR:xax01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     XACM_2646 (tpiA)
Exosome [BR:xax04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   XACM_2646 (tpiA)
  Exosomal proteins of bladder cancer cells
   XACM_2646 (tpiA)
  Exosomal proteins of melanoma cells
   XACM_2646 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3037781..3038536)
Genome map
AA seq 251 aa AA seqDB search
MRRKIVAGNWKLHGSRAFATELVAKVAAHMPLEGVEVVILPPLPYLGDLIEDFEAHHLSF
GAQDVSSNEKGAYTGEVSASMLVDVGAGYGLVGHSERRQYHHESSELVARKFAAAMHAGL
IPVLCVGESLEQREAGQTEAILRAQLDPVLALVGSAGFAGSVLAYEPIWAIGTGRTATPE
QAQAVHAFLRGEVAKADARIADSLPILYGGSVKPDNAGELFAQPDVDGGLVGGASLVAED
FLAIARAAAAC
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgaaagatcgttgccggaaattggaagctgcatggcagccgcgccttcgccacc
gaactggtggccaaggtggccgcgcacatgcccctggagggtgtcgaagtcgtcatcctg
ccgccactgccttacctcggcgacctgatcgaggatttcgaggcccatcacctgtcgttc
ggagcccaggacgtcagcagtaatgagaagggcgcctacaccggcgaggtctcggcctcc
atgctggtcgatgtcggtgccggctacgggctggtcggccactccgagcgccgccagtac
caccatgagagcagcgagctggtggcgcgcaagtttgccgccgccatgcatgccggactg
attccggtgctgtgcgtgggcgaatcgctggaacagcgtgaagccggtcagaccgaggca
atcctacgtgcccagctcgacccggtcctggcgctggtcggcagcgccggtttcgcaggc
tcggtgctggcctacgaaccgatctgggccattggcaccggccgcactgcgaccccggag
caggcccaggccgtacacgccttcctgcgtggcgaagtcgcgaaggcggatgctagaatc
gccgattcgctgcccatcctgtacgggggcagtgtcaagcccgacaacgccggcgagctg
ttcgcgcagcctgacgtcgatggcgggctagtcggaggcgcgtcactggtcgccgaagat
ttcctggccatcgcacgcgcggcggccgcgtgctaa

DBGET integrated database retrieval system