KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_2646Help
Entry
XACM_2646         CDS       T01616                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
xax00010  Glycolysis / Gluconeogenesis
xax00051  Fructose and mannose metabolism
xax00562  Inositol phosphate metabolism
xax01100  Metabolic pathways
xax01110  Biosynthesis of secondary metabolites
xax01120  Microbial metabolism in diverse environments
xax01130  Biosynthesis of antibiotics
xax01200  Carbon metabolism
xax01230  Biosynthesis of amino acids
Module
xax_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:xax00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XACM_2646 (tpiA)
   00051 Fructose and mannose metabolism
    XACM_2646 (tpiA)
   00562 Inositol phosphate metabolism
    XACM_2646 (tpiA)
Enzymes [BR:xax01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     XACM_2646 (tpiA)
Exosome [BR:xax04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   XACM_2646 (tpiA)
  Exosomal proteins of bladder cancer cells
   XACM_2646 (tpiA)
  Exosomal proteins of melanoma cells
   XACM_2646 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEO42900
UniProt: G2LXK8
Position
complement(3037781..3038536)
Genome map
AA seq 251 aa AA seqDB search
MRRKIVAGNWKLHGSRAFATELVAKVAAHMPLEGVEVVILPPLPYLGDLIEDFEAHHLSF
GAQDVSSNEKGAYTGEVSASMLVDVGAGYGLVGHSERRQYHHESSELVARKFAAAMHAGL
IPVLCVGESLEQREAGQTEAILRAQLDPVLALVGSAGFAGSVLAYEPIWAIGTGRTATPE
QAQAVHAFLRGEVAKADARIADSLPILYGGSVKPDNAGELFAQPDVDGGLVGGASLVAED
FLAIARAAAAC
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgaaagatcgttgccggaaattggaagctgcatggcagccgcgccttcgccacc
gaactggtggccaaggtggccgcgcacatgcccctggagggtgtcgaagtcgtcatcctg
ccgccactgccttacctcggcgacctgatcgaggatttcgaggcccatcacctgtcgttc
ggagcccaggacgtcagcagtaatgagaagggcgcctacaccggcgaggtctcggcctcc
atgctggtcgatgtcggtgccggctacgggctggtcggccactccgagcgccgccagtac
caccatgagagcagcgagctggtggcgcgcaagtttgccgccgccatgcatgccggactg
attccggtgctgtgcgtgggcgaatcgctggaacagcgtgaagccggtcagaccgaggca
atcctacgtgcccagctcgacccggtcctggcgctggtcggcagcgccggtttcgcaggc
tcggtgctggcctacgaaccgatctgggccattggcaccggccgcactgcgaccccggag
caggcccaggccgtacacgccttcctgcgtggcgaagtcgcgaaggcggatgctagaatc
gccgattcgctgcccatcctgtacgggggcagtgtcaagcccgacaacgccggcgagctg
ttcgcgcagcctgacgtcgatggcgggctagtcggaggcgcgtcactggtcgccgaagat
ttcctggccatcgcacgcgcggcggccgcgtgctaa

DBGET integrated database retrieval system