KEGG   Xanthomonas alfalfae: XACM_2656Help
Entry
XACM_2656         CDS       T01616                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
xax  Xanthomonas alfalfae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xax00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XACM_2656 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XACM_2656 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XACM_2656 (trpA)
Enzymes [BR:xax01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     XACM_2656 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3047768..3048574)
Genome map
AA seq 268 aa AA seqDB search
MRRIDSCFAELRANGRKALIPFITAGDPSLEATVPVMHALVRAGADVIELGVPFSDPMAD
GPTIQRSSERALGRGAGLAYVLEAVHEFRREDATTPVVLMGYLNPIEIHGTRRFAEAAVA
AGVDGVLLVDLPPEEAGETRAIFTEVGLALIALASPTTSEQRLDMLCSTAQGYLYYVSFA
GVTGASNLLDTHAASDRLRQLRQRAGAPVVAGFGIKDAASAAAMAVDADGVVVGSALVAA
LADAGEVRSARERAEAFLAPLRQALDQK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgtatcgattcctgcttcgccgagctgcgtgccaatgggcgcaaggcactgatc
cccttcatcaccgccggcgacccatcgttggaagccaccgtgccggtgatgcacgcgctg
gtgcgcgccggtgccgatgtgatcgagctgggggtgcctttctccgaccccatggccgac
ggtcccaccatccagcgcagctccgagcgcgcgctgggccgcggtgccggcctggcgtat
gtgctcgaagcggtgcacgagttccgccgcgaagatgccaccaccccggtggtgttgatg
ggctacctcaacccgatcgagatccatggcacgcgacgcttcgccgaagccgcggtcgcc
gcgggcgtggatggtgtgctgctggtcgacctgccgccggaagaagccggcgaaacgcgc
gccatcttcaccgaggtcggcctggcgctgatcgcactggcctcgcccaccaccagcgag
cagcgcctggacatgttgtgcagcaccgcgcagggctatctgtactacgtcagctttgcc
ggcgtcaccggcgcctccaatctgctcgacacccatgccgccagcgatcgcctgcgccag
ctgcgccagcgtgccggcgcgccggtggtggccggcttcggcatcaaggatgcggccagc
gccgctgccatggccgtggatgccgacggcgtggtggtgggcagtgccctggtcgccgca
ttggcggacgcaggcgaggtccgcagcgcccgtgagcgcgccgaagcgttcctggccccg
ttgcgccaggcgctcgaccagaaatga

DBGET integrated database retrieval system