KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_2656Help
Entry
XACM_2656         CDS       T01616                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
xax00260  Glycine, serine and threonine metabolism
xax00400  Phenylalanine, tyrosine and tryptophan biosynthesis
xax01100  Metabolic pathways
xax01110  Biosynthesis of secondary metabolites
xax01130  Biosynthesis of antibiotics
xax01230  Biosynthesis of amino acids
Module
xax_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xax00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XACM_2656 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XACM_2656 (trpA)
Enzymes [BR:xax01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     XACM_2656 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA TMP-TENI PcrB DUF561
Motif
Other DBs
NCBI-ProteinID: AEO42910
UniProt: G2LXL8
Position
complement(3047768..3048574)
Genome map
AA seq 268 aa AA seqDB search
MRRIDSCFAELRANGRKALIPFITAGDPSLEATVPVMHALVRAGADVIELGVPFSDPMAD
GPTIQRSSERALGRGAGLAYVLEAVHEFRREDATTPVVLMGYLNPIEIHGTRRFAEAAVA
AGVDGVLLVDLPPEEAGETRAIFTEVGLALIALASPTTSEQRLDMLCSTAQGYLYYVSFA
GVTGASNLLDTHAASDRLRQLRQRAGAPVVAGFGIKDAASAAAMAVDADGVVVGSALVAA
LADAGEVRSARERAEAFLAPLRQALDQK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgtatcgattcctgcttcgccgagctgcgtgccaatgggcgcaaggcactgatc
cccttcatcaccgccggcgacccatcgttggaagccaccgtgccggtgatgcacgcgctg
gtgcgcgccggtgccgatgtgatcgagctgggggtgcctttctccgaccccatggccgac
ggtcccaccatccagcgcagctccgagcgcgcgctgggccgcggtgccggcctggcgtat
gtgctcgaagcggtgcacgagttccgccgcgaagatgccaccaccccggtggtgttgatg
ggctacctcaacccgatcgagatccatggcacgcgacgcttcgccgaagccgcggtcgcc
gcgggcgtggatggtgtgctgctggtcgacctgccgccggaagaagccggcgaaacgcgc
gccatcttcaccgaggtcggcctggcgctgatcgcactggcctcgcccaccaccagcgag
cagcgcctggacatgttgtgcagcaccgcgcagggctatctgtactacgtcagctttgcc
ggcgtcaccggcgcctccaatctgctcgacacccatgccgccagcgatcgcctgcgccag
ctgcgccagcgtgccggcgcgccggtggtggccggcttcggcatcaaggatgcggccagc
gccgctgccatggccgtggatgccgacggcgtggtggtgggcagtgccctggtcgccgca
ttggcggacgcaggcgaggtccgcagcgcccgtgagcgcgccgaagcgttcctggccccg
ttgcgccaggcgctcgaccagaaatga

DBGET integrated database retrieval system