KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_2658Help
Entry
XACM_2658         CDS       T01616                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xax00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XACM_2658 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XACM_2658 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XACM_2658 (trpB)
Enzymes [BR:xax01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     XACM_2658 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3049041..3050258)
Genome map
AA seq 405 aa AA seqDB search
MSAQPISDFYAYPDAAGHFGKFGGRFVAETLIGPLQELSAAYDQARQDPSFIAEYDKDLK
HYVGRPSPIYHAERLSREVGGAQILLKREDLNHTGAHKINNTIGQALLASRMGKTRIIAE
TGAGQHGVASATVAARLGLECVVYMGATDIERQKINVYRMKLLGATVIPVTSGSATLKDA
LNEAMRDWVTNVRDTFYIIGTVAGPDPYPRMVRDFNAIVGREAREQMLQEYGRLPDAISA
CVGGGSNAIGLFHAFLNDPGVKIYGAEAAGDGIATGRHAASIAAGRPGVLHGNRTYVICD
DDGQITETHSISAGLDYPGVGPEHSFLSDSGRAVYQGITDDEAMAAFHLLAHTEGILAAL
ESSHAVAQSIKLARELPRDALVLCNLSGRGDKDVHTIAAREGIAL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcccagcccatcagtgacttttacgcctatccggatgctgccggtcacttcggc
aagttcggtggccgtttcgtcgccgaaaccttgatcggcccactgcaggaattgtccgcc
gcttacgatcaggcgcggcaggacccgagtttcattgccgaatacgacaaggacctcaag
cattacgtcggccggcccagcccgatctaccacgccgagcggctcagccgtgaagtgggt
ggggcgcagatcctgctcaagcgcgaagacctgaaccacaccggcgcgcacaagatcaac
aacaccatcggccaggcgctgttggccagccgcatgggcaagacccgcatcatcgccgag
accggcgccggccagcacggcgtcgccagtgccaccgtggcggcacgcctgggcctggaa
tgcgtggtctacatgggcgccaccgacatcgagcggcaaaagatcaacgtctaccgcatg
aagctgctcggcgccacggtgatcccggtgacttccggctcggccacgctcaaggacgcg
ctcaacgaagccatgcgcgactgggtgaccaacgtgcgcgacaccttctacatcatcggc
accgtggctggcccggacccatacccgcgcatggtgcgcgacttcaatgcgattgtcggt
cgcgaggcgcgcgaacagatgctgcaggagtatggccggctgccggatgcgatcagtgcc
tgcgtgggtggcggcagcaatgcgatcggtttgttccatgccttcctcaatgatccgggc
gtcaagatctatggcgccgaagcggccggcgatggcatcgccaccggccgccacgccgcc
tccatcgccgcaggtcgcccgggcgtgctgcacggcaaccgcacctacgtgatctgcgac
gacgacggccagatcaccgagacccattcgatttccgccggcctggattacccgggtgtg
ggcccggagcattcgttcctgtccgacagcggtcgcgcggtgtaccagggcatcaccgac
gacgaggcgatggccgccttccatctgctggcgcataccgaaggcattcttgccgcgctc
gagtccagccatgcggtggcgcagtcgatcaagcttgcgcgcgagctgcccagggatgcg
ctggtgttgtgcaatctgtccgggcgtggcgataaggatgtgcataccatcgcagcgcgc
gaggggatcgctctttaa

DBGET integrated database retrieval system