KEGG   Xanthomonas alfalfae: XACM_2995Help
Entry
XACM_2995         CDS       T01616                                 

Gene name
nahA
Definition
beta-hexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
xax  Xanthomonas alfalfae
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xax00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    XACM_2995 (nahA)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    XACM_2995 (nahA)
Enzymes [BR:xax01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     XACM_2995 (nahA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3443485..3445935
Genome map
AA seq 816 aa AA seqDB search
MTSNSAPTARLTAIAPFSSRLLALAFAAVSLAGCGQRAPGTSPAAATAGAPAAATADTAG
TPLPLIPAAVEVKRGSGSFTVGAGTVISIVPGDADARRSAEHLADLLQRTRGLRLEVRAE
ASASPGSIRLERSARAPVAHKEGYSLEADARGVRIAARDGAGLLYGAISAWQLMTPDARK
GEVRLPAVAIRDWPRFSWRGQHLDVARHFHDVDTVKHVLDTMALHKLNVLHWHLTDDQGW
RIEIKRYPKLTEVGAWRTPPGAGQHGTPQRYGGFYTQEQISEIVAYAARLHITVLPELDM
PGHAQAAVAAYPEDVGVPGAHTQVGVDWGVNPYLFNTSERSLTFITNVLDEVLTLFPSTY
IHIGGDEAVKDQWETSPAVRAQMRKLGVKNAHAMQGWFNEQLAAYLTQHGRRMIGWDEIL
EGGVPASASVMSWRGIEGAVTAAQQGHDVVLAPGDWLYLDNLQTTRSDEPNGRLTVLPLS
KVYAFDPVPAELSAEQARHVLGAQGALWSEYIPSRWHVDHALFPRLSAIAEVTWSPPAAR
SWNSFLARMPAQLQRYKALGIDYSDGAFAADIALEGGPNPVLAGGPAKVTLSTQAGAGTL
HYTIDGSEPTPASPRYSAPLTIRLPTTVKATAFDANGTPLAATRSRTFDRASLLRVDTQG
LQHCVETGALGLRLPLLPEMTGADTPVYNVDLFHACRLYPQARLDGIGAIRIDAARLPNN
FGLAHEQSKVVQYPAKTRGGELEVRLGCDGDLIASVQLPRSDTLGEQFTLETALPARTGI
HDLCLRFTAPIRGPLYAIGAVQLIETTAQAPPAATR
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcgaactccgcacccaccgcacgcctgacagccatcgcgccgttctcctcgcgc
ctgcttgcgcttgcgttcgcagcagtatcgctggccggctgcggtcaacgtgcgccaggc
acctcgccggccgctgccaccgcgggcgcacctgctgccgcaaccgcagacactgcgggt
accccgttgccactgattcccgcagcagtcgaggtcaaacgcggtagcggcagcttcacg
gtgggcgccggcacggtgatttcgatcgtgcccggcgatgccgatgcacgccgcagtgcc
gaacatctggccgatttgctgcaacgcacacgcgggctgcggttggaagtgcgcgccgaa
gccagcgcatcgccgggcagcatccgcctggagcgcagcgcgcgggcgccggtagcgcac
aaggaaggctatagcctggaggccgatgccaggggcgtgcgcatcgccgcgcgcgatggc
gccggcttgttgtacggcgcaatcagcgcctggcaattgatgacaccggatgcacgcaag
ggcgaggtccggctgccggcggtggcgattcgcgactggccgcgtttcagctggcgcggc
cagcacctggatgtagcccggcatttccatgatgtggacacggtcaagcatgtgctcgat
acgatggccctgcacaagctcaacgtgctgcattggcatctcaccgatgaccagggctgg
cgcatcgagatcaagcgctatcccaagctcaccgaggtaggcgcatggcgcacaccgccc
ggcgccggccagcacggcacgccgcagcgttatggcggcttctacacccaggaacagatc
agcgagatcgtcgcctatgcggcgcgcctgcatatcaccgtgctgcccgaactggacatg
cccggccatgcacaggcagccgttgccgcctaccccgaagacgtgggcgtacccggcgca
cacacgcaggtgggcgtggactggggcgtcaacccgtacctgttcaacaccagcgaacgt
agcctgaccttcatcaccaacgtgctggacgaagtgctgaccttgttcccgtcgacctac
atccatatcggtggcgatgaggcggtgaaggatcaatgggaaacctcgccggcggtgcgc
gcgcagatgcgcaagctcggggtcaagaacgcgcatgcgatgcagggctggttcaacgaa
cagctggcggcctacctcacccagcacggtcggcgcatgatcggctgggatgaaattctg
gaaggcggcgtgccggccagtgcgtcggtgatgtcgtggcgcggcatcgaaggcgcggtg
actgcagcacagcaaggccacgatgtggtgctggcgccgggcgactggctgtatctggac
aacctgcagaccacccgcagcgacgaaccgaacggtcgcctcacggtgttgccgctgtca
aaggtctacgcattcgacccggtaccggccgagctcagcgccgaacaggccaggcatgta
ctgggcgcacaaggcgcgttgtggtccgaatacatcccctcgcgctggcatgtggatcac
gccttgttcccgcgtttatctgcaatagcggaagtgacctggtcgccgccggcagcgcgc
agttggaatagctttctggcccgcatgccggcgcagctgcagcgctacaaggcgctgggc
atcgattacagcgacggcgccttcgctgccgatatcgcgctggaaggcggacccaatccg
gtgctcgccggcgggccggccaaggtgacactgagcacgcaagccggcgcgggcacgctg
cactacaccatcgacggcagcgagcccacgccggcatcgccgcgctacagcgcgccgttg
acgattcgcttgccgaccacggtcaaggccacggcgttcgatgcgaacggcacgccgctg
gcggccacgcgcagccgtaccttcgatcgcgccagtttgttgcgggtggatacgcaggga
ctgcagcactgcgtcgaaaccggcgcgctcggcttgcggctgccgctgctgccggagatg
accggcgccgacacgccggtgtacaacgtcgacctgttccatgcctgccgcctgtatccg
caggcacggctggacggtatcggcgcaatccgcatcgacgccgcacgcctgcccaacaac
ttcggcctggcgcacgagcaatccaaggtcgtgcaataccccgccaaaacccgcggcggt
gagctggaagtgcgtctgggctgcgacggcgatctgatcgccagcgtgcagctgccgcgc
agcgacaccctgggcgaacaattcaccctggaaaccgcactgcctgcacgcaccggcatc
cacgatctctgcctgcgcttcaccgcgccgatccgcggccccctgtatgccatcggcgcc
gtccaactgattgaaaccactgcgcaggcgccccccgccgccacgcgctga

DBGET integrated database retrieval system