KEGG   Xanthomonas alfalfae: XACM_3000Help
Entry
XACM_3000         CDS       T01616                                 

Gene name
bga1
Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
xax  Xanthomonas alfalfae
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:xax00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    XACM_3000 (bga1)
Enzymes [BR:xax01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     XACM_3000 (bga1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3456161..3457996
Genome map
AA seq 611 aa AA seqDB search
MLRTTLAPLVLALALALPAAAATPEPWPAFGTQGTQFVRAGKPYQLLSGAIHFQRIPRAY
WKDRLQKARALGLNTVETYVFWNLVEPQQGQFDFSGNNDVAAFVREAAAQGLNVILRPGP
YACAEWEAGGYPAWLFGKGNIRVRSRDPRFLAASQSYLDALAKQVQPLLNHNGGPIIAVQ
VENEYGSYADDHAYMADNRAMYVKAGFDKALLFTSDGADMLANGTLPDTLAVVNFAPGEA
KSAFDKLIKFRPDQPRMVGEYWAGWFDHWGKPHAATDARQQAEEFEWILRQGHSANLYMF
IGGTSFGFMNGANFQNNPSDHYAPQTTSYDYDAILDEAGHPTPKFALMRDAIARVTGVQP
PALPAPIATATLPATPLRESASLWDNLPAPIAIDTPQPMEQFGQDYGYILYRTTVTGPRK
GPLYLGDVRDVARVYVDQRPVGSVERRLQQVSLEVEIPAGQHTLDVLVENSGRINYGTRM
ADGRAGLVDPVLLDNQQLTGWQAFPLPMRTPDSIRGWTRKAVQGPAFHRGALRIGTPTDT
YLDMRAFGKGFAWANGVNLGRHWNIGPQTALYFPAPFQRKGDNTVVVFDLDDVATPSVRG
LKQQVWLTPKE
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgtaccactcttgctcccctggttctggccctggcgctcgcgctacccgccgcc
gctgccacacccgagccctggcccgccttcggcacgcagggcacgcaattcgtgcgcgcc
ggcaagccgtaccagctgctctccggcgccatccatttccagcgcattccgcgcgcctac
tggaaagaccgcctgcaaaaagcgcgtgccctgggcttgaacaccgtagaaacctacgtg
ttctggaacctggtggaaccgcagcaaggccagttcgatttttccggcaacaacgatgtg
gccgcgttcgtgcgcgaagccgccgcgcagggcctcaacgtcatcctgcggcccggccct
tacgcctgtgcggagtgggaagccggcggctacccggcctggttgttcggcaagggcaat
attcgcgtccgcagccgcgatccgcgctttctcgccgccagccagtcctatctggatgcg
ttggccaaacaggtgcagccgctgctcaaccataacggcgggccgatcatcgccgtgcag
gtcgagaacgaatacggctcctacgccgacgatcacgcctacatggccgacaaccgcgcc
atgtacgtcaaggctggcttcgacaaggccttgctgttcacctccgatggcgccgacatg
ctcgccaacggcaccttgcccgacaccctggcggtggtgaacttcgcacccggcgaggcc
aagagcgcattcgacaaactgatcaagttccgccccgatcaaccgcgcatggtcggcgaa
tactgggccgggtggttcgaccattggggcaagccgcatgccgcaaccgatgccaggcaa
caggccgaggagttcgagtggatcctgcgccagggccactcggccaatctctacatgttc
atcggcggcaccagtttcggcttcatgaatggcgccaatttccagaacaatcccagcgac
cactacgcgccgcagaccaccagttacgactacgacgccatcctcgacgaagccggccac
cccacgcccaaattcgcgttgatgcgcgatgccatcgcccgcgtgaccggcgtgcaaccg
cccgcattaccggcaccgatcgccaccgccacgctgccggccacgccgctgcgcgaatcg
gcctcgctctgggacaacctgcccgcgccgatcgccatcgacaccccgcagccgatggaa
cagttcggccaggattatggctacatcctctaccgcaccacggtcactggcccgcgcaag
ggcccgctgtatctgggcgacgtgcgcgatgtggcacgcgtgtacgtggatcaacggccg
gtcggcagcgttgagcggcgtttgcagcaggtgtcgctcgaggtggagattcctgcaggc
cagcacaccctggatgtgctggtcgaaaacagcggccgcatcaactacggcacgcgcatg
gccgacggccgcgccgggctggtggacccggtgctactggacaaccagcagctcaccggc
tggcaggccttcccgctgccgatgcgcacgcccgacagcatccgcggctggacccgcaag
gcagtgcaaggcccggcgtttcaccgcggcgccctgcgcatcggcacgccgaccgacacc
tatctggacatgcgcgccttcggcaagggctttgcctgggccaacggcgtcaacctgggc
cgccattggaacatcggcccgcagaccgcgctgtatttccccgcgccgttccagcgcaag
ggtgacaacacggtggtggtcttcgacctggacgatgtcgccacccccagcgtgcgcggc
ctgaagcagcaggtgtggctcacgccgaaagagtga

DBGET integrated database retrieval system