KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_3283Help
Entry
XACM_3283         CDS       T01616                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:xax00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3801891..3802502)
Genome map
AA seq 203 aa AA seqDB search
MRGTLYIVAAPSGAGKSSIVNATLARDPKIALSISFTSRAPRPGERHAEHYHFVSADEFQ
GMIEAGDFFEYALVHGDWKGTARQSVEPQLAAGHDVLLEIDWQGARQVRQKVPDAVSVFI
LPPSRQALDERMRKRGQDSEDVMAQRLAAAREEMLHFEEFDYVIINETFDIAVAEMCAIF
TASRLRRQAQQQRHAGLIQALLE
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggcactctctatatcgttgcggccccctccggcgccggcaagagcagcatcgtc
aacgccaccctggcacgcgacccgaagatcgccctgtcgatctcgttcacctcgcgcgcg
ccgcggccgggcgaacggcatgccgagcactaccatttcgtctccgccgacgagttccag
ggcatgatcgaggcgggcgacttcttcgaatatgcgctggtgcatggtgactggaagggc
accgcgcggcagtcggtggagccgcagctggccgccggccacgacgtcctgctggagatc
gactggcagggcgcgcgtcaggtgcgccagaaggtgcccgatgcggtcagcgtgttcatc
ctgccgccgtcgcgccaggcattggacgagcgcatgcgcaagcgcgggcaggacagtgag
gacgtgatggcgcaacgcctggccgccgcccgtgaagagatgctgcatttcgaagagttc
gattacgtgatcatcaacgagaccttcgacatcgccgtggcggagatgtgcgccatcttc
accgccagccggctgcgtcggcaggcgcaacagcagcggcacgccggattgatccaggcg
ctgctggagtaa

DBGET integrated database retrieval system