KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_3327Help
Entry
XACM_3327         CDS       T01616                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:xax00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XACM_3327 (pfkA)
   01230 Biosynthesis of amino acids
    XACM_3327 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XACM_3327 (pfkA)
   00030 Pentose phosphate pathway
    XACM_3327 (pfkA)
   00051 Fructose and mannose metabolism
    XACM_3327 (pfkA)
   00052 Galactose metabolism
    XACM_3327 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    XACM_3327 (pfkA)
Enzymes [BR:xax01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     XACM_3327 (pfkA)
Protein phosphatases and associated proteins [BR:xax01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     XACM_3327 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3847682..3848938
Genome map
AA seq 418 aa AA seqDB search
MTTGNLLYAQSGGVTAVINATAAGVIAEARARKIKVLAARNGILGALREELIDTSKESAA
AIAALAQTPGGAFGSCRYKLKSLEEDSAKYERLLDVLRAHDVRWFLYNGGNDSADTAWKV
SQLAKAYGYPLHCIGVPKTIDNDLAVTDTCPGFGSAAKYTAVSVREAALDVAAMADTSTK
VFIYEAMGRHAGWLAAAAGLAGQDPDDAPQIILLPERAYDQAAFLAKVKQVVDKVGWCVV
VASEGIQDAHGKFVADAGGATDSFGHAQLGGVASFLAAQVKQELGYKVHWTLPDYLQRSA
RHLASKTDWEQAQAVGKAAVQYAIKGMNAVIPVIERVSDAPYRWKIVPAPLHKVANHEKK
MPPSFLRKDGFGITERARRYFAPLIKGEAPLAYGSDGLPKYVSLKNVAVAKKLPAWEG
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgaccactggcaacctgctctatgcccaatccggcggcgtcaccgccgtcatcaacgcc
actgcagccggcgtcatcgccgaagcgcgcgcacgcaagatcaaggtgctggccgcacgc
aacggcatcctgggcgccttgcgcgaggagttgatcgacacctccaaagagtccgctgcc
gccattgccgccctggcgcagacgcccggcggtgcattcggctcgtgccgctacaagctc
aaatcgctggaagaagacagcgccaagtacgagcgtctgctcgacgtgctgcgcgcgcac
gacgtccgctggttcctctacaacggcggcaacgactcggccgacaccgcgtggaaggtc
tcgcagctcgcaaaggcctatgggtacccgctgcactgcatcggcgtgccaaagaccatc
gacaacgatctggcagtgaccgacacctgccccggcttcggctcggcggccaagtacacc
gccgtctcggtacgcgaggccgcactggatgtcgccgccatggccgacacctccaccaag
gtcttcatctatgaggcgatgggccgccatgccggctggctggccgcagcggcaggcctg
gccgggcaagacccggacgacgccccgcagatcatcctgctgcccgaacgcgcctacgac
caggctgcattcctggccaaggtgaaacaggtggtggacaaggtgggctggtgcgtggtg
gtggccagcgagggcatccaggacgcacacggcaagttcgtcgccgatgccggcggcgcg
accgactcgttcggccatgcacagctcggcggcgtggcctcgttcctggccgcacaggtc
aagcaggagcttggctacaaggtgcactggacgctacccgattacctgcagcgctccgcg
cgccatctggcatcgaagacggactgggaacaggcgcaagcagtcggcaaggccgccgtg
cagtacgcgatcaagggcatgaacgcggtgatcccggtgatcgaacgcgtcagcgacgca
ccataccgctggaagatcgtgcctgcgcccctgcacaaggtggccaatcacgaaaagaag
atgccgcccagcttcctgcgcaaggacggcttcggcatcaccgaacgcgcccgccgctat
ttcgccccgttgatcaagggcgaagccccgctggcctacggcagcgatggcttgccgaag
tatgtgagtttgaagaatgtcgcggtggcgaagaagttgccggcttgggaagggtga

DBGET integrated database retrieval system