KEGG   Xanthomonas alfalfae: XACM_3354Help
Entry
XACM_3354         CDS       T01616                                 

Gene name
pcm
Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
xax  Xanthomonas alfalfae
Brite
Enzymes [BR:xax01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     XACM_3354 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3886328..3886984
Genome map
AA seq 218 aa AA seqDB search
MTIDFTQAREKMVEQQIRPWDVLDLRVLDVLARMPREAFVPEAYKTLAYVDVEIPLSAGH
KMMKPVVEGRMLQALDLQPGEDVLEIGTGSGFATACLAALAREVLSLEIDPALAAAARAN
LDRTGLGSNVRIETADVFGWQSERRFDAICVTGAVDTLPVQWLQWLRPNGRLFVVRGHDP
VMEAVLVRGEVNAPRIESLFETDLAYLQGAAPTPRFQF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcgatttcacccaggcccgcgaaaagatggtcgagcagcagatccggccgtgg
gacgtgctggacctgcgcgtactcgacgtgctggcgcgcatgccgcgcgaagccttcgtg
ccggaggcctacaagacgctggcctatgtcgacgtggaaattccgctgtcggccggtcac
aagatgatgaagccggtggtcgaaggccgcatgttgcaggcactggacctgcaaccgggc
gaggacgtactggaaatcggcaccggcagcggctttgccaccgcctgcctggccgcactg
gcgcgcgaagtcctcagcctggagatcgacccggcgctggccgcggctgcgcgcgccaat
ctggaccgcaccggcctgggcagcaacgtccgtatcgaaaccgccgatgtcttcggctgg
cagagcgagcgtcgctttgacgccatctgcgtgaccggcgcagtcgacacgctgcccgtc
cagtggctgcagtggttgcgcccgaacggccggttgttcgtcgtgcgcggtcacgacccg
gtgatggaagcggtcctggtccgtggcgaggtcaacgccccgcgcatcgaatcgttgttc
gaaaccgacctcgcctatctccagggcgccgcaccgacgccccgattccaattctga

DBGET integrated database retrieval system