KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_3410Help
Entry
XACM_3410         CDS       T01616                                 

Definition
(GenBank) endo-1,4-D-glucanase
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3966495..3967649)
Genome map
AA seq 384 aa AA seqDB search
MTRRRLLHAGALAGVAALLPAAARAAPSQCGPWPLWSAFVDKHIQPDGRVVDFLNPDQRS
TSEGQSYALFFALVNNDQVLFDKVLSWTRHNLCGGRPDLHLPAWLWGRDGSGAWRVLDAN
TASDGELWIAYALLEAGRLWSRPGYLKAGQQMLQLIRTQEVATLPGLGPMMLPGRTGFVD
NGRWTLNPSYLPIQVLRRCANADPKGPWAAIAANSARLLRDSAPVGFAPDWTVWDGKTFN
ADPKRGNVGSYDAIRVYLWAGMLDAGEPLRARLLKDLSGPADLLAAQQTPAEKIDTARGV
GTGALPVGFSAALLPYLSALGKPALLKAQAQRVPAAAQPAAAALPYFERTLALFGQGWLE
NRYRFAADGRLLPAWRTPACAATT
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgccgtcgcctgctgcatgcaggcgcattggccggcgtggccgcgctgctgccg
gcagccgcgcgggcggcgcccagccagtgcgggccgtggccgctgtggagcgccttcgtc
gacaagcacatccagcccgatgggcgggtggtggattttctcaatcccgatcaacgctcc
acctccgaagggcagtcgtatgcgctgttcttcgcattggtcaacaacgaccaggtgctg
ttcgacaaggtgctgagctggacccgccacaacctgtgcggcggccgcccggatctccac
ctgccggcatggctgtggggccgcgatggcagcggcgcctggcgcgtgctggacgccaac
actgccagcgatggcgagttgtggattgcctatgcgctgctggaagccggacggttgtgg
agccgcccgggctacctcaaggccggccagcagatgctgcagctgatccgcacccaggaa
gtggccacgctgcccgggctgggcccgatgatgctgccgggccgcaccggtttcgtcgac
aacgggcgctggacgctcaatcccagctatctgccgatccaggtgctgcgtcgttgcgcc
aatgccgaccccaagggcccatgggctgccattgccgccaacagcgcgcgcctgctgcgt
gacagcgcgccggtggggtttgccccggattggacggtgtgggacggcaagaccttcaat
gccgatcccaagcgcggcaatgtcggcagttacgacgccatccgcgtgtacctgtgggcc
ggcatgctggacgctggcgagccgctgcgcgcgcgattgctgaaggacctgtccggaccg
gccgacctgctcgccgcgcagcagacgccggccgaaaagatcgacaccgcgcgcggtgtg
ggcaccggcgccctgccggtgggattttctgcggcgttgctgccgtacctgagcgcactg
ggcaagcccgcgctgctcaaggcgcaggcgcagcgggtgcccgccgccgcgcaaccggcc
gccgctgcattgccgtatttcgaacgcacgctggccctgttcggacagggatggcttgag
aaccgctaccgcttcgccgcagacgggcgcctgttgcccgcctggagaacccctgcatgt
gccgcaacgacctga

DBGET integrated database retrieval system