KEGG   Xanthomonas alfalfae: XACM_3442Help
Entry
XACM_3442         CDS       T01616                                 

Gene name
dsbC
Definition
disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
xax  Xanthomonas alfalfae
Brite
Enzymes [BR:xax01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     XACM_3442 (dsbC)
Secretion system [BR:xax02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   XACM_3442 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4019127..4019924)
Genome map
AA seq 265 aa AA seqDB search
MYRLAIAALLGAISLTACAQSSQPAASTAGAKPAAAPAATGTVDQRVSTALKALDPDFKP
DYIGAAPFPGFREVVVGGQVLYVSDDGRYLIQAQPFDIQNKQFAASPGLLAYRRKQLDTV
PKADRIVFAPANPKYTVTVFTDVECGYCRKLHSEIGELNKQGIAVEYLAFPRMGLGSQDH
KEMIAVWCAADRKQALTAAKSGQPVASKDCKNPVSMEYNLGQRLGVNGTPAIFAPDGTQL
GGYLPPAQLREALEKRAVSTAGGSR
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgtcttgccatcgccgcgctgctgggcgcgatcagccttaccgcctgcgcacaa
tcctcgcagcctgcggcaagcactgccggcgccaagcccgccgccgcgcccgccgccacc
ggcacggtggaccagcgcgtgagcacggcgctcaaggcgctggacccggatttcaagccc
gattacatcggtgctgcgccgttccccggcttccgcgaagtggtcgtcggcgggcaggtg
ctatacgtcagcgacgacggccgttacctgatccaggcgcagccgttcgacatccagaac
aagcagttcgccgccagcccgggcttgctggcctaccgccgcaagcagcttgacaccgtg
cccaaggccgaccgcatcgtgttcgcgccggccaacccgaagtacaccgtcaccgtcttc
accgatgtggaatgcggctactgccgcaagttgcatagcgagatcggcgagctcaacaag
cagggcatcgcggtggaatacctcgcgttcccgcgcatgggcctgggcagccaggaccat
aaggaaatgattgcggtgtggtgcgctgccgatcgcaagcaggcgctcaccgctgccaag
tcgggtcagccggtcgcctccaaggactgcaagaacccggtgtcgatggaatacaacctt
ggccagcgcctgggcgtcaacggaacgccggcgatcttcgcgcccgacggcacccagctc
ggtggctacctgccgccagcgcagttgcgtgaggcgctggaaaagcgtgccgtgagcacg
gcaggcggcagccgctga

DBGET integrated database retrieval system