KEGG   Xanthomonas alfalfae: XACM_3474Help
Entry
XACM_3474         CDS       T01616                                 

Gene name
xanA
Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
xax  Xanthomonas alfalfae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xax00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XACM_3474 (xanA)
   00030 Pentose phosphate pathway
    XACM_3474 (xanA)
   00051 Fructose and mannose metabolism
    XACM_3474 (xanA)
   00052 Galactose metabolism
    XACM_3474 (xanA)
   00500 Starch and sucrose metabolism
    XACM_3474 (xanA)
   00520 Amino sugar and nucleotide sugar metabolism
    XACM_3474 (xanA)
  Nucleotide metabolism
   00230 Purine metabolism
    XACM_3474 (xanA)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XACM_3474 (xanA)
Enzymes [BR:xax01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     XACM_3474 (xanA)
    5.4.2.8  phosphomannomutase
     XACM_3474 (xanA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4055259..4056605
Genome map
AA seq 448 aa AA seqDB search
MTLPAFKAYDIRGRVPDELNEDLARRIGVALAAQLDQGPVVLGHDVRLASPALQEALSAG
LRASGREVIDIGLCGTEEVYFQTDYLKAAGGVMVTASHNPMDYNGMKLVREQARPISSDT
GLFAIRDTVAADTAAPGEPTASEQSRTDKTAYLKHLLSYVDRSTLKPLKLVVNAGNGGAG
LIVDLLAPHLPFEFVRVFHEPDGNFPNGIPNPLLPENRDATAKAVKDNGADFGIAWDGDF
DRCFFFDHTGRFIEGYYLVGLLAQAILAKQPGGKVVHDPRLTWNTVEQVEEAGGIPVLCK
SGHAFIKEKMRSENAVYGGEMSAHHYFREFAYADSGMIPWLLIAELVSQSGRSLADLVEA
RMQKFPCSGEINFKVADAKASVARVMEHYASLSPELDYTDGISADFGQWRFNLRSSNTEP
LLRLNVETRGDAALLETRTQEISALLRG
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgacgctacccgccttcaaggcctacgacattcgcggccgtgtgccggatgaactcaac
gaggacttggcccgccgcatcggcgtggcgctggcggcgcagctggatcaagggccggtg
gtcctgggccacgacgtgcgcctggccagcccggcgctgcaggaagcgctttcggccggc
ctgcgcgccagtggccgtgaagtgatcgacatcggcctgtgcggcaccgaggaagtctat
ttccagaccgattacctcaaggctgccggcggcgtgatggtgaccgccagtcacaacccg
atggactacaacgggatgaagctggtccgcgagcaagcgcgaccgatcagctcggacacc
ggtctgttcgccatccgcgacacggtcgcggccgataccgcagcgcctggcgagcccacc
gccagtgagcagagccgcaccgacaagaccgcgtacctgaagcacctgctcagctacgtg
gaccgcagcacgctcaagccgctcaagctggtggtcaatgccggcaacggcggcgccggt
ctgatcgtcgacctgcttgcgccgcatctgccgttcgagttcgtgcgcgtgttccatgag
cccgatggcaacttccccaacggcattccgaacccgctgctgccggaaaaccgtgacgcc
accgccaaggcggtcaaggacaacggcgccgatttcggtatcgcgtgggacggcgacttc
gaccgttgtttcttcttcgatcacaccggccgcttcatcgaaggctattacctggtcggc
ctgctggcacaggccatccttgccaagcagccgggcggcaaggtcgtgcacgacccgcgc
ctgacctggaacacggtcgagcaggtcgaagaagccggcggcattccggtgctgtgcaag
agcggccacgccttcattaaggaaaagatgcgcagcgaaaatgccgtctacggcggcgag
atgagcgcgcaccactatttccgcgagttcgcctacgcagactccggcatgattccgtgg
ctgctgatcgccgaactggtgtcgcagtcgggccgttcgctggccgatctggtcgaagcg
cgcatgcagaaattcccctgcagcggcgagatcaacttcaaggtggccgatgccaaggcc
tctgttgcccgcgtgatggagcattacgcgtcgttgtcgccggagctggattacaccgac
ggcatcagcgccgattttggtcaatggcgtttcaacctacggagctccaataccgagccg
ctgctgcgcctgaacgtggaaacgcgcggcgatgccgcactgctggaaacgcgtacgcag
gaaatttccgccttgctgcgcggctga

DBGET integrated database retrieval system