KEGG   Xanthomonas alfalfae: XACM_3622Help
Entry
XACM_3622         CDS       T01616                                 

Gene name
cheR4
Definition
methylase of chemotaxis methyl-accepting protein
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
xax  Xanthomonas alfalfae
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:xax00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    XACM_3622 (cheR4)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    XACM_3622 (cheR4)
Enzymes [BR:xax01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     XACM_3622 (cheR4)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     XACM_3622 (cheR4)
Two-component system [BR:xax02022]
 CheA family
  CheA-CheYBV
   XACM_3622 (cheR4)
Bacterial motility proteins [BR:xax02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    XACM_3622 (cheR4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4208638..4212180)
Genome map
AA seq 1180 aa AA seqDB search
MTDDETSNNDIATDANTQPPLFVLGVGAAGMDADRLAELLDAIAGASNLAIMLLLRDRQL
LDEARLRELLGSQATLLSVPSDGDRLQPGRFYLPPADTVVTLEEGRIRLRALPNGESDHG
LIDSFFVSMAHDQDGNVIGLIMGRFDGDGTLGTAAIKECGGLALAVDDAALHGLDLRSAS
NPAAITDDILPLPQVAARIVAHMQRHHGYGHPVPTGVRNGSESDKLSQVAAILRSTTGHD
FHGYKRATFLRRVQRRMQAAQVETLEQYLEVLLNRFDEPVQLFNDLLIGVTKFFRDRREF
EFLEQQVIPRLFQGKHTGDSLRIWVLGCSTGEEAYSLAMLLREHAETLDTAPRIQIFASD
IDGRALATARVGRYASSIVGEVAPERLRRWFVKEGDTYVVSKELRELCVFSQHSIVKDPP
FSRLDMVSCRNLLIYLDAELQNRVIPIFHFAIRPGGYLFLGNAENVSRHAQLFTPVERSF
RVFQRIDAQSNVHATFPTMQPAAAARVPAPPQRQRTSSNALVRAGERIADRYAPAYAVLD
EQFEVLHFSSQAGRFIRPGGGTPSLNLLNLIHRDLRLDLRSALSRAERDRSPVHVKGIQV
HEDAATWAVNLFVEPTADSEVPRGYVVLFQEVEAREPVELPAPHDSVHDDGHVQVLENEL
RITRERLQSMIEELESTNEELKSSNEEYQSLNEELQSANEELETSKEELQSVNEEVTTVN
GELAHRVQELAHANSDLKNLLESTQIATVFLDNELRVTNFTPAVTDILPLVESDIHRPIS
HIKLHVDYDELQDDARRVIRTLAVLDREVENPTTHARYMVRVLPYRTVDNFIGGAVLTFM
DVTPLTRAERALRSSEQRLRTLMEGIPQLVWRSLDGGRWTWSSPQWSSYTGQSDAESLDL
GWLQAVHPDDRELTMNAWLGSASSGGLDIEHRLFNADEQGYRWFQTRSAPVRDERGQVLE
WLGTSTESDNLRRLQEEQRVLVAELQHRTRNLITVVQSVAKQTVQTTQSMPEFAAKFEDR
LAALSRVQGLLSQSDNMPTTIGALLRMELDALGAEPDQKRIVLEGQNVALRKSTVQTLAL
ALHELATNAVKHGALAVDTGTLSIRWEVVSDSEIPARLKLLWIEEGANNQLRGDRDEVSG
FGRRLIEKALPYSHGAQTRYELSDTRLECEIQLPLNPVNG
NT seq 3543 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgacgaaacttccaacaacgacatcgctacggatgcgaacacgcagccgccc
ttgttcgtgcttggcgtgggcgccgccggcatggacgccgatcgcctggcagaattgctc
gatgcgattgctggcgcgtcgaatctggccatcatgctgctgttgcgcgaccgccaatta
ttggatgaggcacgcctgcgcgaactgcttggcagtcaggccaccctgctgtcggtaccc
agcgatggcgaccggctgcaaccggggcgcttctatctgccgccggccgatacggtcgtc
acgctggaggaagggcgcattcgcttacgtgcgttgcccaacggcgagagcgaccacggc
ttgatcgacagcttcttcgtctcgatggcgcacgaccaggatggcaatgtgatcggcctg
atcatggggcgcttcgatggcgacggtacgctgggaaccgcggcgatcaaggaatgcggg
ggcctggcgctggccgtggacgatgccgcactgcatgggttggacctgcgcagtgccagc
aacccggctgccatcaccgacgacatcctgcccctgccccaggtcgccgcgcggatcgtg
gcgcacatgcaacgccaccacggctacggtcatccggtgccgaccggcgtgcgcaatggc
agcgaaagcgacaagctcagccaggtcgccgccatcctgcgcagcaccaccggccacgat
tttcatggctacaaacgcgcgacctttctgcgccgcgtgcaacggcgcatgcaggcggcg
caggtggaaacgctggagcagtatctggaggtattgctcaatcgcttcgacgaaccggtg
cagctgttcaacgacctgctgatcggcgtgaccaagttctttcgcgaccgccgcgagttc
gaattcctcgagcaacaggtgattccgcggttgttccagggcaagcacaccggcgacagc
ctgcgcatctgggtgctgggctgctccacgggcgaagaggcctattcgctggcgatgctg
ctgcgcgaacacgccgaaaccctggacaccgcgccacgcatccagatcttcgccagcgat
atcgacgggcgcgcactggccactgcgcgggtggggcgctacgcctccagcatcgtcggg
gaggttgcgcccgaacggctgcggcgctggttcgtcaaggaaggcgacacctatgtggta
agcaaggagctacgcgagctgtgcgtgttttcgcagcacagcatcgttaaggacccgccg
ttttcacggctggatatggtgtcgtgccgcaatctgctgatctatctggatgccgaattg
cagaatcgggtgatcccgatctttcatttcgccatccgtccgggcggctacctgttcctg
ggcaatgccgaaaacgtctcgcggcacgcgcagttgtttacgccggtcgagcgcagcttt
cgggtgtttcagcgcatcgatgcgcagagcaacgtgcatgcaacattcccgaccatgcag
ccggctgcggccgccagggtgcctgcaccaccgcagcggcagcgcacgtccagcaatgcg
ttggtgcgcgccggcgagcgcatcgccgaccgttatgcgccggcgtatgcggtgctggat
gagcagttcgaggtgctgcatttctcgtcgcaggcggggcgcttcatccgtcctggcggc
ggcacccccagcctcaacctgctcaacctgattcatcgcgatttgcgcctggacttgcgc
agcgcgctcagccgcgccgaacgcgaccgctcaccggtgcacgtcaagggcatccaggtg
cacgaagatgcggcgacctgggcggtgaacctgttcgtcgagccgaccgccgactcggag
gtgccgcgcggctacgtggtgctgttccaggaagtggaagcgcgcgaaccggtggagctg
cccgccccacacgacagcgtgcacgacgatgggcatgtgcaagtgctggagaacgagctg
cgcatcacccgcgagcgcctgcaatcgatgatcgaagagctggaaagcaccaacgaggag
ctcaagtcttccaacgaggaataccagtcgctcaacgaagaactgcagagcgccaacgag
gagctggaaacctccaaggaagagctgcaatctgtcaacgaggaagtgaccaccgtcaac
ggtgagctggcccatcgcgtgcaggagctggcgcatgccaacagcgatctgaagaacctg
ctggaaagcacccagatcgctaccgtgtttttggacaacgaattgcgcgtcaccaacttc
acgccggccgtcaccgacatcctgccgctggtggaaagcgatatccatcgcccgatcagc
cacatcaagctgcatgtggattacgacgaactgcaagacgatgcgcgccgggtgatccgc
accctggcggtgctcgatcgcgaggtcgaaaaccccaccacgcatgcgcgctacatggtg
cgcgtgctgccgtatcgcaccgtggacaatttcatcggtggtgcggtgctgaccttcatg
gacgtcaccccgctcacgcgcgccgagcgtgcgctacgcagcagcgagcaacgcctgcgc
accttgatggaaggcatcccgcagctggtgtggcgctcgctcgatggcggccgctggacc
tggtccagcccgcaatggtccagctacaccggccagagcgatgctgagagccttgacctg
ggctggttgcaggcggtgcacccggacgatcgcgagctgaccatgaacgcctggctgggg
agtgcgtccagtggcgggctggatatcgaacaccgccttttcaacgcggatgagcagggt
tatcgctggtttcaaacgcgcagcgctccggtacgcgacgaacgcggccaggtgctggaa
tggctgggtacctccaccgaatcggacaacctgcgccggctgcaggaagaacagcgtgta
ctggtggccgagttgcagcaccgcacgcgcaatctgatcacggtggtgcagtctgtagcc
aagcagactgtacagaccacccaaagcatgcccgagtttgcggccaagttcgaggatcgg
ctggccgcattgtcgcgcgtgcaggggctgctgtcgcaatcggacaatatgcccaccacc
atcggcgcgttgttgcgtatggagctggatgcgttgggggcagagccggatcaaaaacgc
atcgtgctggaaggtcagaacgtggcgctgcgtaaatccaccgtgcagacgcttgcattg
gcattgcacgaattggccaccaacgcggtcaagcatggcgcactggcggtggacaccggc
accttgtcgatccgctgggaggtcgtgtctgacagcgaaatacctgcgcgcctcaagctg
ttgtggatcgaagaaggcgccaacaatcagctgcgcggcgaccgtgatgaagtcagcggc
ttcggtcgccgcctgatcgaaaaggccttgccgtacagccatggcgcgcagacgcgctac
gagctcagcgatacgcgcctggaatgcgaaatccagttgccgctcaatcctgtgaacggg
tga

DBGET integrated database retrieval system