KEGG   Xanthomonas alfalfae: XACM_3806Help
Entry
XACM_3806         CDS       T01616                                 

Gene name
manB
Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
xax  Xanthomonas alfalfae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xax00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XACM_3806 (manB)
   00030 Pentose phosphate pathway
    XACM_3806 (manB)
   00051 Fructose and mannose metabolism
    XACM_3806 (manB)
   00052 Galactose metabolism
    XACM_3806 (manB)
   00500 Starch and sucrose metabolism
    XACM_3806 (manB)
   00520 Amino sugar and nucleotide sugar metabolism
    XACM_3806 (manB)
  Nucleotide metabolism
   00230 Purine metabolism
    XACM_3806 (manB)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XACM_3806 (manB)
Enzymes [BR:xax01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     XACM_3806 (manB)
    5.4.2.8  phosphomannomutase
     XACM_3806 (manB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4399512..4401818)
Genome map
AA seq 768 aa AA seqDB search
MRTSGPVLGGILLLLAVWFGWNSYAQWRQDAVAQGLEQARDRAVQDVGQAMATQASQLDA
VLKQPPVIAALAGGDALAAASAIRERFKGAEDVQVLPGDLAAAYANPKDFGYARLSLLES
AQVADRAQVRVVREAKQVRLGVAAAVRLGGQPAVAYARLPLLRLTGPLDAIAAPDSAYLA
VRQGSYNVAQQGDMALADAAETLARPLGTSGLRVAAAVPQGDSGLLGLGAVGCAIVAALL
LIIAVLLVLASRGQVALPRRRVADQSGADEPTFSQSLQHDASVASEARALDAEAPPAPPA
LVPAVQVATEMFRAYDIRGVVGKDLNPGVAALVGQAIGSVMQAQGLRDVVVGRDGRLSGP
ELSNGLIEGLRRAGCNVTDIGLAPTPVVYFGAYELRAGSCVAVTGSHNPPDYNGFKIVIG
GETLSGAAIAELHQRINEGRLHTAATPGELEQRDISDAYIQRIADDVQLDRPIKVVVDAG
NGVAGEIAPRLLEAIGAEVVPLYCDIDGTFPNHHPDPSEPHNLNDLVKMVQRFDADIGVA
FDGDADRLGVVTKEGAMVFPDRLLMLFAADVLQRNPGALVIYDVKCTGKLSDYVLRNGGS
PLMWKTGHSLIKSKMRETDAELAGEMSGHFFFKERWYGFDDGIYAAARLLEILAQREETP
SDVLDALPESVSTPEIKVPVEGDAHALVARFVARAQTGEESPFESARLSTIDGLRADFID
GWGLVRASNTTPILVLRFEADSEAALQRIRTLFRNELQTLLPEHPLAF
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtacgagtggtccggtgttggggggcatattgctgttgctggccgtctggttcggc
tggaacagttatgcgcaatggcgccaggacgcggtggcgcaagggctggagcaggcacgc
gaccgcgcggtgcaggacgtcggccaggccatggccacccaggccagccagctcgacgcg
gtgctcaagcagccgccggtcatcgctgcgttggccggtggcgacgcgctggcggccgca
tcggccatccgcgagcgcttcaagggcgccgaggatgtgcaggtgctgcctggcgacctt
gccgcggcctatgccaaccccaaggatttcggttacgcgcgtctgagcctgctcgaatcg
gcgcaggtggccgaccgggcgcaggtccgggtggtacgcgaggccaaacaagtccgcctg
ggcgtggctgccgcggtgcgccttggcgggcagccggcggtggcgtatgcgcggttgccg
ttactgcgcctgaccggcccgctggatgcaatcgcggcaccggacagcgcctacctggcc
gtgcgccagggcagctacaacgtggcccagcagggcgatatggcactggccgatgcggcc
gaaacgctggccaggccgcttgggaccagcggcttgcgcgtggctgcggcggtgccgcaa
ggcgacagcggcctactgggcctgggcgccgtcggttgcgccatcgtggcggcattgctg
ctgatcattgcggtactgctggtgctggccagccggggtcaggtggccttgccacggcgc
cgggttgccgaccaatccggcgccgatgaacccaccttcagtcagagcctgcagcacgac
gccagcgttgccagcgaggcacgcgcgctggacgccgaggcaccgccggcaccgccagcg
ctggtgccggcggtgcaggtcgccaccgagatgttccgtgcctacgacatccgcggcgtg
gtcggtaaggacctcaaccccggcgttgccgccttggtgggccaggccatcggcagcgtg
atgcaggcgcagggactgcgcgatgtggtggtcggtcgcgacggccggctgtccgggccg
gagctgagcaacggcctgatcgaaggcctgcgccgcgccggctgcaacgtcaccgacatc
ggcctggcaccgacgccggtggtgtacttcggcgcctacgagctgcgtgccggcagctgc
gtggcggtcaccggcagccacaatccgccggactacaacggtttcaagatcgtgatcggc
ggcgagaccttgtccggcgccgccatcgccgaactgcaccagcgcatcaacgaaggtcgc
ctgcataccgccgccacgcctggcgaactggaacagcgcgacatcagcgatgcctacatc
cagcgtatcgccgatgacgtccagctcgatcgcccgatcaaggtggtggtggacgccggc
aacggcgtggccggtgagatcgcaccgcgcctgctggaagcgatcggcgccgaagtggtg
ccgttgtactgcgacatcgatggcaccttccccaaccatcaccctgatccgagcgagccg
cacaacctcaacgatctggtgaagatggtgcagcgtttcgatgcggatatcggcgtggcg
ttcgatggcgatgccgatcgcctgggcgtggtgaccaaggaaggcgcgatggtgttcccc
gaccgcctgctgatgctgttcgccgccgatgtcctgcagcgcaatcctggcgcattggtc
atttacgacgtgaagtgcaccggcaagctgtccgactacgtgttgcgcaacggcggtagt
ccgctgatgtggaagaccgggcattcgctgatcaaatccaagatgcgcgagaccgatgcc
gaactggccggcgagatgagcggccacttcttcttcaaggagcgctggtacggctttgac
gacggcatctacgccgccgcacgcctgctggaaatcctggcccagcgcgaggaaacccct
tccgacgtgctggacgccctgcccgagagcgtctccacgccggagatcaaggtgccggtg
gaaggcgatgcgcatgcgctggtggcgcgctttgtcgcgcgtgcgcagaccggcgaagaa
tcgccgttcgaatcggcgcggctgtcgaccatcgacgggctgcgcgcggacttcatcgac
ggctgggggctggtacgcgcctccaatacaacgccgatcctggtgctgcggttcgaagcc
gacagcgaggccgcattgcagcggattcgcacgctgttccgcaacgaactgcagacgttg
ttgccggagcatccattggcgttttga

DBGET integrated database retrieval system