KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_3878Help
Entry
XACM_3878         CDS       T01616                                 

Gene name
argI
Definition
(GenBank) arginase
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xax00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XACM_3878 (argI)
  Amino acid metabolism
   00220 Arginine biosynthesis
    XACM_3878 (argI)
   00330 Arginine and proline metabolism
    XACM_3878 (argI)
Enzymes [BR:xax01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     XACM_3878 (argI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4476489..4477412)
Genome map
AA seq 307 aa AA seqDB search
MATQYVPVSLIGVPTDIGAGHRGARMGPEALRIAGLQEALVGRGVEVRDLGNLDGPRNPW
QAPQAGYRHLDEVVAWNQALMDASYAELRAGRMPIMLGGDHCLGIGSITAVAKYCREQGR
PLRVLWLDAHSDFNTSEVTPSGNVHGMPVACLCGLGPESLTHLGGSAPALLPEQVRQIGI
RSVDPEEKRLIKQHRIDVYDMRYIDEAGMKRTMEAALQGMSADTHLHVSFDVDFLDPSIA
PGVGTTVPGGPNYREAQLVMEMIADTGRMGSLDIVELNPVLDNRNATAELAVDLVESLFG
KSTLMRD
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgcagtacgtgccggtttccttgattggcgttcccaccgacatcggcgcgggc
caccgcggcgcgcgcatggggccggaggcgctacgcatcgccggcctgcaggaggcgctg
gtcggccgcggcgtggaggtgcgcgatctgggcaatctggatggtccgcgcaatccctgg
caggcgccgcaggccggctaccggcatctggacgaagtggtggcgtggaaccaggcgctg
atggacgccagctacgccgaactgcgtgccgggcgcatgccgatcatgctcggtggcgac
cattgcctgggtatcggctcgatcacggcggtggccaagtactgccgcgagcagggcagg
ccgttgcgggtgctgtggctggatgcgcattcggatttcaacaccagcgaggtgactcct
tcgggcaacgtgcacggcatgccggtggcctgcctgtgcgggctggggcccgagtcgctg
acccacctgggcggcagtgcgccggcgttgttgcccgagcaggtgcggcagatcggcatc
cgctcggtggacccggaggaaaagcggctgatcaagcagcaccgcatcgatgtgtacgac
atgcgctacatcgacgaagccggtatgaagcgcaccatggaagcggcgttgcagggcatg
agcgccgatacgcacctgcacgtgagtttcgatgtggacttcctcgaccccagcatcgcg
ccgggcgtgggcaccacggtgcccggtggccccaactaccgcgaggcgcaactggtgatg
gaaatgattgccgacaccgggcgcatgggctcgttggatatcgtcgaactcaacccggtg
ctggacaaccgcaatgcgaccgccgaactggcggtggatctggtcgagagcctgttcggc
aagtcgacgctgatgcgggattga

DBGET integrated database retrieval system