KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_3908Help
Entry
XACM_3908         CDS       T01616                                 

Gene name
hemB
Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
xax00860  Porphyrin and chlorophyll metabolism
xax01100  Metabolic pathways
xax01110  Biosynthesis of secondary metabolites
xax01120  Microbial metabolism in diverse environments
Module
xax_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:xax00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    XACM_3908 (hemB)
Enzymes [BR:xax01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     XACM_3908 (hemB)
Exosome [BR:xax04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XACM_3908 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: AEO44145
UniProt: G2LXQ0
Position
complement(4505870..4506862)
Genome map
AA seq 330 aa AA seqDB search
MAHPHYRPRRMRHDGFSRRLMRENTLTTDDLIWPVFVHELSGRAPIASMPGVERLSLDEL
LREAENALELGIPVIDLFPVIDPAGKSLDAAEAWNPDGLAQRAVRALKSRFPELGVMTDV
ALDPYTTHGQDGIIDAKGYVLNEITVEALVKQSLSHAQAGVDIISPSDMMDGRIGAIRRA
LDADDHLNVRIMAYSAKYASAFYGPFRDAVGSAGNLGKADKTTYQMDPANGDEALREIAL
DLEEGADMVMVKPGMPYLDVVRRVKDQFRVPTFAYQVSGEYAMLKAASANGWLDERKCVL
EALMAFKRAGADGVLTYFAPQVARWLRETR
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggcccacccgcactatcgcccccgccgcatgcgccacgatgggttttcgcgtcggttg
atgcgcgagaacacgctgaccaccgatgacctgatctggccggtgttcgtacacgaactg
tccggccgcgcgccgatcgcgtcgatgcccggcgtggaacgcctgtcgctggacgagctg
ctgcgcgaggcggaaaacgcgctggaactgggcatcccggtgatcgacctgttcccggtg
atcgacccggccggcaagagcctggacgcggccgaagcctggaacccggacggcctggcg
cagcgcgcggtgcgggcgttgaagtcgcgcttcccggagctgggcgtcatgaccgacgtg
gcgctggacccgtacaccacccacggccaggacggcatcatcgacgcgaagggttatgtg
ctcaacgagatcacggtcgaggccttggtcaagcaatcgttgtcgcatgcgcaggcgggc
gtggacatcatttcgccttcggacatgatggatggccgcatcggtgcgatccgccgcgcg
ctcgatgccgacgatcatctcaacgtgcggatcatggcgtattcggccaagtacgcctcg
gcgttctacggccccttccgcgatgcggtaggcagcgccggcaatctgggcaaggccgac
aagaccacctaccagatggacccggccaacggcgatgaagccttgcgcgagatcgccctg
gatctggaagaaggcgcggacatggtgatggtcaagccgggcatgccgtatctggatgtg
gtgcgccgggtgaaggatcaattccgcgtgccgacctttgcgtaccaggtcagcggcgag
tacgcgatgctcaaggcggcgtcagccaatggctggctggacgagcgcaagtgcgtgctc
gaagcattgatggccttcaagcgtgccggcgccgatggcgtgttgacctatttcgccccg
caagtggcgcgttggttgcgcgaaacgcgctga

DBGET integrated database retrieval system