KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_4040Help
Entry
XACM_4040         CDS       T01616                                 

Gene name
phoD2
Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:xax00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:xax00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:xax02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4676763..4678334
Genome map
AA seq 523 aa AA seqDB search
MTVSDPARRRILQGLGAGVLLPATAGWSARSLAAPSGRPTITDGVQSGDVLDDRAMLWSR
ADRPARLRVEWDTRPSLRQARRVDGTIASAAHDFTARADLRGLPRDQDIFYRVRFEDADS
GVLSAPVHGHLRSAPQARGDVRFVWSGDTVGQGFGINPDIGGMRIYSAMRERNPDFFLHS
GDTIYADSPIPAELTVEDGKRWRNLTTAAKSKVAETLDEFRGNYRYNLLDAHVRRFNAEV
PQLWQWDDHETTNNWSPGKQLDARYQVRDIDVLARRARQAFLEYAPMRGVRADGSGRIYR
KIAYGPLLDVFVLDMRSYRGANSDNLQPRPGPDAAFLGPEQLAWLQRELAGSRAQWKVIA
ADMPIGLQVPDGEDGNGRPRWEAIANGDPGVPRGREQEIATLLRFISRARIRNTVWLTAD
VHYCAAHYYHPDRAAFQQFEPFWEFVGGPLNAGSFGPNALDATFGPSVVFQKAPPAPNTS
PLAGYQFFGEVDIDGRSGVLTVTLRDLDGVAQFRQPILPHGVA
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgactgtctccgatcccgcccgtcgccgcatcctgcaaggcttgggtgccggcgtgttg
ctgccggccactgccggttggtcagcgcgcagcctggccgcgccgtcgggacgacccacc
atcaccgacggggtgcagagcggcgatgtgctggacgaccgcgccatgctgtggagccgt
gccgatcgcccggcgcggttgcgggtggaatgggacacccgcccaagcctgcgtcaggcg
cggcgcgtggacggcacgatcgcatcggcggcgcacgacttcaccgcacgtgcggacctg
cgcggcctgccacgcgaccaggacatcttctatcgcgtgcgtttcgaagatgccgacagc
ggtgtgttgagcgcgcccgtccacggccatctgcgcagcgcaccgcaggcgcgtggcgat
gtgcgctttgtctggagcggcgacacggttggccagggcttcggcatcaacccggacatc
ggcggcatgcgcatctactcggcgatgcgcgagcgcaatccggatttcttcctgcacagc
ggcgacaccatctacgccgacagcccgatcccggccgagctgacggtggaagacggcaag
cgctggcgcaatctcaccaccgcggccaaaagcaaggtggccgagacgctggacgaattt
cgcggcaactatcgctacaacctgctcgatgcgcacgtgcgccgcttcaatgccgaggtg
ccgcaactgtggcaatgggacgaccacgaaaccaccaacaattggtcgcccggcaagcaa
ctggatgcgcgctatcaggtgcgcgacatcgacgtgctggccaggcgcgcccgccaggcg
tttctggaatacgcgccgatgcgcggcgtgcgcgccgacggcagcgggcgtatctaccgc
aagattgcctacggcccgttgctggatgtgttcgtgctggacatgcgcagctaccgcggc
gccaacagcgacaacctgcaaccgcggcccggtcccgatgccgcgtttctcgggccggag
caactggcgtggttgcagcgcgaactggccggctcgcgcgcgcaatggaaggtgattgcc
gccgacatgccgatcggcctgcaggtgccggatggcgaagatggaaacgggcgcccgcgc
tgggaggcgattgccaatggcgaccccggcgtgccacgtggccgcgaacaggaaatcgcc
acgctgttgcgcttcatcagccgcgcacgcatccgcaatacggtttggctcaccgccgac
gtgcattactgcgcggcgcactactatcaccccgatcgcgccgcgtttcagcagttcgaa
ccgttctgggaatttgtcggcggcccgctcaatgccggcagtttcgggcccaatgcactg
gatgccacgttcggcccgagcgtggtgtttcaaaaagcgccacctgcgcccaacacctcg
ccgctggccggttaccagttctttggcgaagtggacatcgatggccgcagcggcgtcctc
acggtgacgttgcgcgacctggatggggtggcgcagttccgtcaaccgattctgccgcac
ggcgtggcgtag

DBGET integrated database retrieval system