KEGG   Xanthomonas alfalfae: XACM_4099Help
Entry
XACM_4099         CDS       T01616                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
xax  Xanthomonas alfalfae
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xax00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    XACM_4099
   00051 Fructose and mannose metabolism
    XACM_4099
Enzymes [BR:xax01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     XACM_4099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4762950..4764287
Genome map
AA seq 445 aa AA seqDB search
MSNTVYIGAKEYFPGIGKIGFEGRDSDNPLAFKVYDANKTIGDKTMAEHLRFAVAYWHSF
CGNGADPFGPGTRAYPWDAGTTALNRAEAKADAAFEFFTKLGVPYYCFHDIDLAPDADDI
GEYEKNLKHMVGIAKQRQADTGIKLLWGTANLFSHPRYMNGASTNPDFNVVARAAVQVKA
AIDATVELGGENYVFWGGREGYACLHNTQMKREQDNMARFLTLARDYGRAIGFKGNFLIE
PKPMEPMKHQYDFDSATVIGFLRQHGLDKDFKLNIEANHATLSGHSFEHDLQVASDAGLL
GSIDANRGNPQNGWDTDQFPTDLYDTVGAMLVVLRQGGLAPGGLNFDAKVRRESSDPQDL
FLAHIGGMDAFARGLEVANALLTASPLEQWRAERYASFDSGAGADFAAGKTTLADLAKHA
AGNAPQQLSGRQEAYENLINQYLTR
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaccgtgtacatcggcgcgaaagaatatttccccggcatcggcaagatcggt
ttcgaaggccgcgattcggacaacccgctcgcgttcaaggtctacgacgccaacaaaacc
atcggcgacaagaccatggccgagcatctgcgctttgccgtggcctactggcacagcttc
tgcggcaatggcgccgacccgttcggcccgggcacgcgtgcgtatccgtgggatgcgggc
actaccgcgttgaaccgtgccgaagccaaggccgatgcggcgttcgagttcttcaccaag
ctcggcgtgccctactactgcttccacgacatcgacctggcaccggatgccgacgacatc
ggcgagtacgaaaagaatctcaaacacatggtgggcatcgccaagcagcgtcaggccgac
accggcatcaagctgttgtggggcacggccaacctgttctcgcatccgcgctacatgaat
ggtgcatcgaccaacccggacttcaatgtcgtggcgcgtgcggcggtgcaggtcaaggcc
gcgatcgatgcgaccgttgaactcggtggcgagaactacgtgttctggggcggccgcgaa
ggctatgcctgcctgcacaacacgcagatgaagcgcgagcaggacaacatggcgcgcttc
ctcaccctggcacgtgattacggccgtgcgattggcttcaagggcaatttcctgatcgag
cccaagcccatggagccgatgaagcaccagtacgatttcgatagcgccacggtgatcggc
ttcctgcgccagcatggcctggacaaagacttcaagctcaacatcgaggccaaccacgcc
acgctgtcgggccatagcttcgagcatgacctgcaggtggcatccgatgccggcctgctc
ggcagcatcgatgccaaccgcggcaacccgcagaacggctgggacaccgaccagttcccg
accgatctgtacgacaccgtcggcgccatgctggtggtgctgcggcagggcgggctggca
ccgggcggactgaatttcgatgccaaggtgcgtcgcgaatcgtccgacccgcaggacctg
ttcctggcccacatcggcggcatggatgcgttcgcacgcgggctggaagtggccaacgcg
ctgctgaccgcctcgccgctggaacagtggcgcgccgagcgttacgccagcttcgacagc
ggcgccggcgcggactttgccgcaggcaagaccacgctggccgatctggccaagcacgcg
gccggcaatgcgccccagcagctcagcggccgccaggaagcgtatgaaaacctgatcaat
cagtatctgacgcgttga

DBGET integrated database retrieval system