KEGG   Xanthomonas alfalfae: XACM_4117Help
Entry
XACM_4117         CDS       T01616                                 

Definition
L-fuculose-phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
xax  Xanthomonas alfalfae
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xax00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    XACM_4117
Enzymes [BR:xax01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     XACM_4117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4786879..4787559)
Genome map
AA seq 226 aa AA seqDB search
MFALEQRQRVVALCIELSRRGYLAGTGGNVALRIDAECFAVTPSAIDYLSMQAEDICIVR
TKDLHQLDGTRTPSVETGLHAQVMRRRPDVGCSIHTHQPVASACTLLGAPLEVTQPALRR
LLGARIPIAGYMPSGTGLLARLLARQLQPTVNAYLLRNHGVVCCGTNLEAAVTVVEALEL
VARSHLQTQIQARAAREPDLAAGLQRVLTALDSSRHTSGASSLSQT
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcccttgaacaacgccagcgcgtggtcgcgctgtgcatcgaactgtcgcgccgc
ggctatctggccggcaccggcggcaatgtcgccttgcgtatcgatgccgagtgtttcgcg
gtcactccctcggcgatcgactacctgagcatgcaggccgaggatatctgcatcgtccgc
accaaggacctgcaccagctcgacggcacgcgcacgccgtcggtcgaaaccggcctgcat
gcgcaggtgatgcggcggcgcccggacgtgggttgcagcatccacacccaccagccggtc
gccagcgcctgcaccctgctgggcgcgccgttggaggtgacgcaaccggcgttgcgccgg
ctgcttggtgcacggattccgatcgccggctacatgccgtcgggcaccggcctgctggcc
cgcctgctggcccggcagctgcagcccaccgtcaacgcctatctgctgcgcaatcacggc
gtggtctgctgcggcaccaacctggaggcggccgtcaccgtggtcgaagcgttggagctg
gtcgcgcgcagccacctgcagacgcagatccaggcgcgtgcggcgcgcgagcccgacctc
gcggccggcctgcagcgggtgctgacggcgctggattccagccggcacacgtccggcgcg
tcctccctttcccagacatga

DBGET integrated database retrieval system