KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_4125Help
Entry
XACM_4125         CDS       T01616                                 

Gene name
xynB
Definition
beta-1,4-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4797946..4798923)
Genome map
AA seq 325 aa AA seqDB search
MLKLRYPLTLVLLLGAYASAVAGPIAAGKQRVLGSAYSPQQAQGFTNYWNADVPENAGKW
GSVEPVRGQMNWGPLDEAYQLAKRNHMQFQFHVGLWGAQQPTWVRNLPPNEQLAAIEHWF
AAIAQRYPDIDLMQVANETLPGHNQPDNRRSDTGNYLRALGGTGATGVDWVLEAFRLARK
YFPHTKLMINDYNVTEYNDQARQYLHTIQLLQQEHLIDAIGIQGHLSSNGPSVSVQRANL
DLLASTGLPIYITEFDLDGRTDAQQLAAWQRFFPMFWEHPAVRGVNVWGFRHGLWRENEG
AYLINYDGSERPALTWLRSYVASRP
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaactccgttatccgctcacgcttgtgctgttgctgggcgcgtatgcgtccgct
gttgccgggcccatcgctgccggcaagcagcgcgtcctgggcagcgcctacagcccacag
caagcgcagggcttcaccaactactggaacgccgacgtgcccgaaaatgcgggcaaatgg
ggcagcgtcgagcccgtgcgcggccagatgaactggggcccgctcgacgaggcttaccag
ttggccaagcgcaaccacatgcaattccagttccatgtcgggctctggggtgcccagcag
ccgacgtgggtgcgcaacctgccgccaaacgagcagcttgcggcgatcgagcactggttt
gccgcgattgcgcagcgctaccccgacatcgacttgatgcaggtggccaacgagacgctg
ccgggtcacaaccagccggacaatcgccgcagcgatacgggcaactatctgcgggcactg
ggcggcaccggggcgaccggcgtggactgggtgcttgaggcattccgcctggcacgcaag
tatttcccccataccaagttgatgatcaacgactacaacgtcaccgagtacaacgaccaa
gccaggcagtatctgcacaccatccagctgctgcagcaagaacacctgatcgatgcgatc
ggcatccaggggcacctgtcgagcaacggcccctcagtttcggtgcagcgcgccaacctc
gacctgttggcgtccaccggactgccgatctacatcaccgagttcgacctggatgggcgt
accgacgctcagcagttggcagcctggcagcgtttcttcccgatgttctgggagcatccg
gccgtgcgtggcgtgaacgtgtggggtttccgtcacggtctatggcgtgaaaatgaaggt
gcgtatctgatcaattacgacggcagcgaacgcccggccttgacctggctacgcagctac
gttgccagcaggccctga

DBGET integrated database retrieval system