KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_4168Help
Entry
XACM_4168         CDS       T01616                                 

Definition
membrane-bound lytic murein transglycosylase B
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:xax00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4853706..4855868)
Genome map
AA seq 720 aa AA seqDB search
MTLARRALPFVLGLLPLAASADPAFDRCLAGLQPQAAAKGVDAASFQRFTAGLAPDPSVL
PLLDAQPEFTTPIWDYLASLVDSQRVSDGQAMLVTHRELLSRLSEQTGVDPATIVAVWGV
ESDYGRVTGKRPLLVSLATLSCAGRRQPFFRGEFLALLSLLQQGDLSAEGLTGSWAGAFG
QTQFMPSTYARIAVDGDGDGRRDLVTSIPDALASTANYLVKAGWERARPWGMEVTLPRGF
DASKAGRTRRQPLQAWQRAGLLGTDGTPLAPAGLPAETPAALLLPAGASGPAFLVFGNYD
AIYAYNAAESYALSIALLADRLRGGPGLIAAWPTDDPGLGRPERRELQQLLLARGYQIGE
ADGMVGSATRRAIQVEQTRLGLQPADGRPGQRILTALRAAPTVTGAAAMRATAFKLPAAY
PAFAQSPSVHKASPMSDTTGLTTGDFHGFPSLLIDTPFSTAAISLFGGQLLSFVPKGGQD
VMWLSPIAKQPPTPIRGGAPVCWPYFGRQDQTGDVPAHGFVRTVAWQLTESRREDDGTVV
LTLTPPRFDDLALRLRMTLRIGRTLEQRLITENTSAAPVRFTQALHNYFRVGDALKVSVQ
GLDGLDYLDKYENYATVHRQQGDWSLRDPRDPGRSDRIYTNAGGRYTLTDPVLGRRVVIA
TEGSRSLVAWNPGEEAGRQMADVGEGWRDYVCLEAANAGPDVIELAPGASHTLTQTISVE
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgacgctggcccggcgcgcattgccattcgtgttgggactgctgccgctggcagcctct
gccgatccggccttcgaccgctgcctggctggcctgcagccccaggccgctgccaagggc
gtggacgctgccagctttcagcgcttcaccgccgggctggcgcccgatcccagcgtgctg
ccgctgctggatgcgcagcccgaattcaccacgcccatctgggattacctggccagcctg
gtcgacagccagcgtgtcagcgacggccaggccatgctggttacccaccgcgagctgctc
agccgcctgtccgaacagaccggcgtggacccggccaccatcgtggcggtgtggggcgtg
gagagcgattacggccgcgtcaccggcaagcgcccgctgctggtgtcgctggccacgctg
tcgtgcgcgggccgccgccagccgttctttcgcggcgaattcctcgccttgctcagcctg
ctgcagcaaggcgatctgtcggcggaaggactcaccggctcctgggccggtgcgttcggg
caaacccagttcatgccttcgacctacgcccgcatcgccgtggatggcgacggcgacggc
cgccgcgatctggtgaccagcattcccgatgcactggcctccaccgccaactacctggtc
aaggccggctgggaacgcgcccgtccgtggggcatggaagtcaccctgccgcggggcttc
gacgccagcaaggccgggcgcacccgccgccaaccgctgcaggcctggcaacgcgccggc
ctgctcggcaccgacggcacaccgctggcaccggccggactgccggcagaaacgccggcc
gccttgctgttgccggccggtgccagcggcccggcgttcctggtgtttggcaactacgac
gcgatctacgcctacaacgccgccgaaagttacgcgctgtccatcgccctgctcgccgat
cgcctgcgtggcggccccggcctgatcgcggcctggcccaccgacgatccgggcctgggc
cggcccgaacggcgcgaactgcagcagttgctgctcgcccgtggctaccagatcggcgag
gccgacggcatggtcggcagcgccacccgccgcgccatccaggtcgagcagacccgcctg
ggcctgcaaccggccgacggccgccccggccagcgcatcctcaccgcgctgcgcgccgcc
ccgacggtcaccggcgccgccgccatgcgcgccaccgcgttcaagctgccggccgcatac
ccggccttcgcccaatcccccagcgtccacaaggcatcccccatgtccgacaccaccggc
ctgaccacaggcgatttccacgggtttccgtcgctgctgatcgataccccgttctccacc
gccgccatcagcctgttcggcggtcagttgctctcgttcgtgcccaagggcggacaggac
gtgatgtggctctcgcccattgccaagcaaccgcctaccccgatccgcggcggcgcgccg
gtgtgctggccgtatttcggccgccaggaccagaccggcgacgtccccgctcacggcttc
gtgcgcaccgtggcctggcaactcaccgaaagccgccgcgaagacgacggcaccgtggtg
ctcacgctcaccccgccgcgtttcgacgacctggcgctgcgcctgcgcatgaccctgcgc
atcggccgcacgctggagcaacgcctgatcaccgaaaacaccagcgccgccccggtgcgt
ttcacccaggcgctgcacaactatttccgtgtcggcgacgcgctcaaggtcagcgtgcag
ggcctggacggcctggactatctcgataagtacgagaactacgccaccgttcaccgccag
caaggcgactggagcctgcgcgacccacgcgaccccggccgcagcgaccgcatctacacc
aatgccggcggccgctacacgctcaccgacccggtgctcggccgccgcgtcgtcatcgct
accgaaggcagccgctcgctggtggcctggaacccgggcgaagaggccggcaggcagatg
gccgacgtgggcgagggctggcgcgactacgtctgcctggaagcggccaatgccggcccg
gacgtgatcgaactcgctcccggcgccagccacaccctgacccagaccatcagcgtcgag
tag

DBGET integrated database retrieval system