KEGG   Xanthomonas axonopodis pv. citrumelo F1: XACM_4175Help
Entry
XACM_4175         CDS       T01616                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
xax  Xanthomonas axonopodis pv. citrumelo F1
Pathway
xax00790  Folate biosynthesis
xax01100  Metabolic pathways
Module
xax_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:xax00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    XACM_4175 (folE)
Enzymes [BR:xax01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     XACM_4175 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF XendoU
Motif
Other DBs
NCBI-ProteinID: AEO44406
UniProt: G2M0I7
Position
complement(4864255..4864857)
Genome map
AA seq 200 aa AA seqDB search
MSQSNQPDSSVTQTQAEEAVRTLLRWAGEDPTREGLLDTPRRVAEAYGDWFSGYREEPRE
YLERTFEEVAGYDELIVLRDISYESHCEHHMAPIIGKVHVGYLPRGKVVGISKLARVVES
YARRFQVQEKMTAQIAQCIQDVLQPLGVGVVVEGAHECMTTRGIHKRGVSMVTSKMLGTF
REDARTRAEFLQFIEVGGKR
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagccagtccaaccagcccgattcctccgtcacccagacccaggccgaagaggccgtg
cgcaccctgttgcgctgggcgggcgaagatcccacgcgcgagggcctgctggacaccccg
cgccgggtggctgaagcctacggcgactggttcagcggctaccgcgaagagccgcgcgaa
tacctggaacgcacgttcgaggaagtggccggctacgacgagttgatcgtgctgcgcgac
atttcctacgaaagccattgcgagcaccacatggcgccgatcatcggcaaggtgcacgtg
ggctacctgccgcgtggcaaggtcgtcggcatcagcaagctggcccgcgtggtggaaagc
tacgcgcgccgcttccaggtgcaggaaaagatgaccgcgcagatcgcccaatgcatccag
gacgtgctgcagccgcttggcgtgggcgtggtggtggaaggcgcgcacgagtgcatgacc
acccgcggcatccacaagcgcggcgtcagcatggtgacctccaagatgctgggcaccttc
cgcgaagacgcgcgcacccgcgccgaattcctgcagttcatcgaagtgggcggcaagcgt
tga

DBGET integrated database retrieval system