KEGG   Xenorhabdus bovienii: XBJ1_0041Help
Entry
XBJ1_0041         CDS       T01186                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
xbo  Xenorhabdus bovienii
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:xbo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    XBJ1_0041 (rbsK)
Enzymes [BR:xbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     XBJ1_0041 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
46001..46930
Genome map
AA seq 309 aa AA seqDB search
MSMAKLAVMGSINADHILNLESFPQPGETVMGKQYQVAFGGKGANQAVAAGRCGADITFI
ACVGQDDIGERVRQQLVKDNINTSAIGVIEGETTGVALIFVNQQGENVIGISAGANGALT
SEYFHHHEQVVKEADVLLLQLETPLETVQLAAETARKHNTKVILNPAPAQKLSEQLLSLV
DIITPNETEAEYLTGIAVKDNVGAEKAAQDLHKKGIEIVIITLGSRGVWLSENGKQGKIV
PGFKVKAIDTIAAGDTFNGALVTGLLEGKGIVSAIRFAHAAAAIAVTRQGAQPAVPWRRE
IDAFLAEQD
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgagtatggcaaaacttgccgtgatgggcagcattaatgcagatcacatcttgaacctc
gaatcttttcctcagcctggggaaaccgtgatgggaaaacagtatcaggttgcatttggg
ggaaagggagctaatcaggcggttgctgcaggtcgctgtggtgctgacattacatttatt
gcttgtgttggccaagatgatattggcgagcgtgtccgtcaacaattggtgaaagataat
atcaatacctcggcaatcggagttattgaaggtgaaacaacgggtgtagcactgattttt
gtgaatcagcaaggggaaaacgtcattggcattagcgcaggagcgaatggcgcactcaca
tctgaatatttccaccatcatgagcaggtggtcaaagaggctgatgtgttgttgttacag
ctcgaaacaccgttggaaactgtacagctggccgctgaaacggccagaaaacataacact
aaagttatcttgaaccctgcgccagcacagaaactctctgaacaattgctttctttggtc
gatattatcactcctaatgaaacagaagcggaatacttaactgggatcgctgtaaaagat
aatgtaggagcagaaaaagccgctcaggacttgcataaaaaaggtattgaaatcgttatt
atcacattgggcagccgtggcgtatggctgagtgaaaatggtaagcaaggtaaaattgtt
cctggatttaaagttaaggcaatcgatacgattgcggcgggcgatacatttaatggcgca
ctggtaacgggattattggaggggaaaggaatcgtatcggcaattcgttttgcccatgct
gcggcagctattgctgtgacacgtcagggagcgcagccagctgttccgtggcgacgtgag
attgatgcatttctggctgaacaggactaa

DBGET integrated database retrieval system