KEGG   Xenorhabdus bovienii SS-2004: XBJ1_0050Help
Entry
XBJ1_0050         CDS       T01186                                 

Gene name
acs
Definition
(GenBank) acetyl-CoA synthetase, has propionyl-CoA synthetase activity
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
xbo  Xenorhabdus bovienii SS-2004
Pathway
xbo00010  Glycolysis / Gluconeogenesis
xbo00620  Pyruvate metabolism
xbo00640  Propanoate metabolism
xbo00680  Methane metabolism
xbo01100  Metabolic pathways
xbo01110  Biosynthesis of secondary metabolites
xbo01120  Microbial metabolism in diverse environments
xbo01130  Biosynthesis of antibiotics
xbo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:xbo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XBJ1_0050 (acs)
   00620 Pyruvate metabolism
    XBJ1_0050 (acs)
   00640 Propanoate metabolism
    XBJ1_0050 (acs)
  Energy metabolism
   00680 Methane metabolism
    XBJ1_0050 (acs)
Enzymes [BR:xbo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     XBJ1_0050 (acs)
Lipid biosynthesis proteins [BR:xbo01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   XBJ1_0050 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CBJ79201
UniProt: D3UY23
Position
complement(57122..59077)
Genome map
AA seq 651 aa AA seqDB search
MTQIIKHLIPADIAETALISKQQYLQDYQWSLQDPEAFWSEKGKIVDWIKPYTQVKNTSF
DPGHVSIRWFEDGTLNLSANCLDRHLQERGEQTAIIWEGDNPAESKHVTYRELYHDVCQF
ANVLKKLDVKKGDVVAIYMPMVPEAAVAMLACTRVGAIHSVIFGGFSPDAIAGRVIDSNA
KLIITADEGIRAGRVIPLKKNVDEALSNPAVTDVVNVVVFKRTGNTKSWQEGRDLWWHEL
IENVSTDCPAEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYASLTFKYTFDYRPGEI
YWCTADIGWVTGHSYLLYGPLSCGATSLMFEGVPNYPDVNRLCQIVDKHQVNIIYTAPTA
IRALMAEGDKAIEGTKRTSLRIMGSVGEPINPEAWEWYYRKIGNSKCPIVDTWWQTETGG
FMITPLPGAVDLKPGSATLPFFGISPALVGNSGEPLTGECEGNLVITDSWPGQARTLFGD
HERFEQTYFSTFKGMYFSGDGARRDEDGYYWITGRVDDVLNISGHRLGTAEIESALVSHP
KIAEAAVVGIPHHIKGQAIYAYVTLNHGEEPSPDLYTEVRNWVRKEIGPIATPDILHWTD
SLPKTRSGKIMRRILRKIASGDTSNLGDTSTLADPGVVEKLLEEKQSMNMT
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgactcagataatcaagcatcttattcctgctgacattgcagaaacggccctgataagc
aaacaacaatatctacaagattaccaatggtcactacaagatcctgaagcgttctggagt
gagaaaggtaagatagtggattggattaaaccttatactcaggttaaaaacacctctttc
gacccagggcatgtcagtatccgctggtttgaagatggcacactgaatttaagtgccaac
tgccttgaccgccatttgcaggaacgtggtgagcaaaccgctatcatctgggaaggagac
aatcccgcagaatccaagcatgttacgtatcgcgagctatatcatgatgtctgccaattc
gccaatgtattgaaaaaacttgatgtcaaaaaaggtgatgtcgttgcgatttatatgcca
atggtacccgaagccgccgttgccatgctggcctgtacccgagttggtgcaatccattcc
gtgatttttggtggtttttctcctgatgccattgctggcagggttatcgattccaatgcc
aagctgattattaccgcagatgaagggatacgtgcaggccgcgttattccattgaaaaag
aatgtcgatgaagcactgagtaatccagccgtaaccgacgttgttaatgtggtagtcttc
aagcgtactggtaacaccaaaagctggcaggaaggtcgtgatttgtggtggcatgagttg
atcgaaaatgtcagcacagattgccctgccgaagaaatgaatgccgaagatccacttttc
atactttatacctctggctcaaccggcaaacctaaaggggttctacataccactggcggt
tatctggtctatgcttctttgactttcaaatacacgtttgattaccgccctggggagatc
tactggtgtacagccgatattggctgggtaaccggccacagctaccttctgtatgggcct
ctctcctgcggtgcaacatcattgatgtttgaaggtgtaccaaactaccccgatgtcaat
cgcctctgtcagatcgttgataaacatcaggttaatattatctatactgcaccaaccgcc
attcgtgcattaatggctgaaggcgataaggcgattgaaggaaccaaacgtacgtcacta
cgtatcatgggctcggtaggtgagccaattaatcctgaagcatgggaatggtactaccgg
aagataggtaacagtaaatgtcctattgtcgatacttggtggcaaaccgaaacaggcggg
ttcatgatcacgcctttgcccggagcagtcgacctcaaaccaggttcggctactttgcca
ttcttcggtatcagtccggcattggtgggcaactcaggtgagccattaactggcgaatgt
gagggtaatcttgtcatcacggattcctggccgggacaagcgcgaactttatttggtgat
catgagcgttttgaacaaacctatttttccactttcaaaggtatgtatttcagcggagat
ggcgctcgacgtgatgaagacggctattactggatcactggccgtgtcgatgatgtcctg
aatatttcaggtcatcggttgggaaccgcagaaattgagtctgcgctggtttcacatcca
aaaattgccgaagctgctgttgttggcattccacaccatatcaaagggcaggcgatttat
gcctatgtcacactgaatcatggtgaagaaccttccccggatctttataccgaagtcaga
aattgggttcgcaaagaaatcggcccgattgcaacacccgatattcttcactggacggat
tctttgcccaaaacgcgttcagggaagatcatgcgccgtatcttgcgcaaaattgcttcc
ggcgataccagtaacttaggtgatacctccacactagcagatccgggtgtcgttgaaaaa
ctgctggaagaaaaacaatccatgaatatgacttaa

DBGET integrated database retrieval system