KEGG   Xenorhabdus bovienii SS-2004: XBJ1_0122Help
Entry
XBJ1_0122         CDS       T01186                                 

Gene name
paaF
Definition
(RefSeq) enoyl-CoA hydratase-isomerase, phenylacetic acid degradation (strain W) (EC:4.2.1.17)
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
xbo  Xenorhabdus bovienii SS-2004
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:xbo00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    XBJ1_0122 (paaF)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    XBJ1_0122 (paaF)
   00650 Butanoate metabolism
    XBJ1_0122 (paaF)
  Lipid metabolism
   00071 Fatty acid degradation
    XBJ1_0122 (paaF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XBJ1_0122 (paaF)
   00310 Lysine degradation
    XBJ1_0122 (paaF)
   00360 Phenylalanine metabolism
    XBJ1_0122 (paaF)
   00380 Tryptophan metabolism
    XBJ1_0122 (paaF)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    XBJ1_0122 (paaF)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    XBJ1_0122 (paaF)
   00281 Geraniol degradation
    XBJ1_0122 (paaF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    XBJ1_0122 (paaF)
   00627 Aminobenzoate degradation
    XBJ1_0122 (paaF)
   00930 Caprolactam degradation
    XBJ1_0122 (paaF)
Enzymes [BR:xbo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     XBJ1_0122 (paaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(125205..125978)
Genome map
AA seq 257 aa AA seqDB search
MSHEWILCHQQQRVRTLTLNRPEVRNALSNDCLEQLVQQLEQADADTGTGAIVITGASRY
FAAGADLRELQQQTVATAMTDRRPQLWQRLHNISKPLIAAVNGYALGAGCELVLACDLVI
CGESARFGLPEITLGLMPGAGGTQRLIRCVGKALANQMILTGEAINAQKAQQAGLVSEVC
IDALTLERAEQIAQRISEFSPLALRAAKAALKTAHETSLSQGLLAERQQFVALAGTADRQ
EGITAFLEKRKPTFKGF
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagtcacgaatggattttatgccaccagcaacaacgggtacgcacactgaccctgaac
cgcccggaagtccgtaatgccctcagcaatgattgtctggagcagctcgtccagcaattg
gaacaggcggatgccgataccggaaccggcgctatcgtcattacaggagcatcacgctat
tttgcggcgggtgccgatctcagggagctacagcagcagaccgttgccacggcaatgaca
gaccgccgcccacaactctggcagcgcttgcacaacatcagcaaacctcttattgcggcc
gtcaatggctacgcactgggtgcaggttgcgaactggtgctggcctgtgatctggtgatt
tgcggtgaaagtgcccgcttcggcctgccggaaattacattgggattaatgccgggcgct
ggcggcacacagcggttaatccgctgtgtgggcaaagcactggccaatcaaatgatccta
actggcgaagcgatcaacgcccagaaagcacagcaggcagggctggtgagcgaagtctgt
atcgatgctctgacattagaacgcgcggaacagattgcccaacgcatcagtgagttttcg
ccgctggcgttacgggcggctaaagctgcactcaagactgcacacgaaaccagcctgtca
caagggctgctcgccgaacgccagcaatttgtcgctctggcagggacagccgatcgccaa
gaaggcattaccgcctttcttgaaaaacgtaaaccaacattcaaagggttctga

DBGET integrated database retrieval system