KEGG   Xenorhabdus bovienii: XBJ1_0334Help
Entry
XBJ1_0334         CDS       T01186                                 

Gene name
cysQ
Definition
sugar phosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
xbo  Xenorhabdus bovienii
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:xbo00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
343529..344269
Genome map
AA seq 246 aa AA seqDB search
MLQQICQLAREAGAAIMVVYQDEQPLKVEHKMDDSPVTAADIAAHKIIKAGLMRIAPDIP
LLSEEDPPVWEERKNWQRYWLVDPLDGTKEFIQRNGEFTVNIALIEDGVPVMGVVYVPVL
NVLYAGQGHQAWKETNGQTIPIKVAAAVLPTVVISRSHIDEELKDYLTQLGTHQTVSVGS
SLKFCMVAEGKAQLYPRFGPTNIWDTAAGHAVAIAAGAHVTDWEGKKLNYAPRESFLNPG
FRVTIF
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgctacaacagatctgccaattggcgcgggaagctggagctgccatcatggtggtttat
caggatgagcagccgttgaaagtagagcataaaatggatgattcacctgttactgctgcg
gatattgccgcccacaagattattaaagcggggttgatgcgtattgcaccggatatcccg
ttgctgtcagaagaagatccccctgtatgggaggagcgcaaaaactggcagcgctactgg
ctggtcgatccgctggatggtacgaaagagtttatccagcgaaacggtgaatttaccgtt
aatattgcattgattgaggatggtgttccggtgatgggcgtcgtttatgttcctgtgctg
aatgttttgtacgcagggcagggacatcaggcttggaaggaaaccaatgggcagacaatt
cctattaaggttgctgctgcagtgctgccgactgtggtgatcagccgttctcacatagac
gaggaattgaaggattatcttactcaattaggaacccatcagacagtttcggtcggatct
tcacttaaattttgtatggttgcagaaggaaaagctcaactttacccgcgctttgggcca
actaatatttgggataccgccgcaggtcacgctgttgcgattgccgcaggtgcacatgtc
acggattgggaaggtaagaagctcaattacgcgccgcgtgaatcttttctgaatccgggg
ttcagagtcactattttttag

DBGET integrated database retrieval system