KEGG   Xenorhabdus bovienii SS-2004: XBJ1_0363Help
Entry
XBJ1_0363         CDS       T01186                                 

Gene name
folP
Definition
(GenBank) 7,8-dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
xbo  Xenorhabdus bovienii SS-2004
Pathway
xbo00790  Folate biosynthesis
xbo01100  Metabolic pathways
Module
xbo_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:xbo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    XBJ1_0363 (folP)
Enzymes [BR:xbo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     XBJ1_0363 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: CBJ79513
UniProt: D3UYY5
Position
369373..370230
Genome map
AA seq 285 aa AA seqDB search
MKLTARGSVLDLSRPQVMGILNVTPDSFSDGGNHSTFDAALRHAATMIEEGAAIIDVGGE
STRPGAVDVSEQEELDRVVPVVEALARRFDAWISIDTSKAIVMQESAKVGAHMINDIRSL
QEFGALDAAVKTGLPVCLMHMQGQPSTMQAEPYYEDAVWETKTFLTRQIDRCVAAGIAKN
KLILDPGFGFGKNLSHNYQLLAHLEEFHHLGLPILAGMSRKSMIGQLLHVPPQECVTGSI
ACAVIAAMQGAQIIRVHDVKETVQTMQIVQATLSAKNILAVKNTL
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgacagccagaggcagtgtcctcgatctttcccgtccacaagtaatggggatt
ctgaacgttactcctgattctttttcagatggaggcaatcacagtacctttgatgccgcg
ttgcggcacgcagccacaatgatcgaggaaggtgcagccattattgatgtgggtggagaa
tcgacacgccctggtgccgtggatgtgagtgagcaggaagaactggatcgcgttgtcccc
gtggttgaagcactggcgcggcgttttgatgcatggatctccatcgatacctcaaaagcc
atagtgatgcaggaatctgctaaagtcggggctcatatgatcaatgatattcgttcgttg
caggagtttggtgcacttgacgcagcagtaaagacgggattgcctgtttgcctgatgcac
atgcagggacaacccagcactatgcaggcagagccatactatgaagatgccgtttgggaa
accaaaacatttttgacgaggcaaattgatcgctgtgttgcggcaggcatcgcaaaaaac
aaactgatccttgatccaggcttcggcttcgggaagaacttatcgcataattatcagcta
ttggctcatttggaagaattccatcatcttggcttgcctattctggctggaatgtcacgc
aaatcaatgattggccaattacttcatgtaccaccgcaggagtgtgtaacaggaagtatc
gcctgcgctgtgattgcagcgatgcaaggtgcccagattattcgtgtgcatgatgtaaaa
gaaaccgtacagacaatgcaaattgttcaggcaacactgtcagcgaaaaacatactggct
gtcaagaacacgctgtga

DBGET integrated database retrieval system