KEGG   Xenorhabdus bovienii: XBJ1_0363Help
Entry
XBJ1_0363         CDS       T01186                                 

Gene name
folP
Definition
7,8-dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
xbo  Xenorhabdus bovienii
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xbo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    XBJ1_0363 (folP)
Enzymes [BR:xbo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     XBJ1_0363 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
369373..370230
Genome map
AA seq 285 aa AA seqDB search
MKLTARGSVLDLSRPQVMGILNVTPDSFSDGGNHSTFDAALRHAATMIEEGAAIIDVGGE
STRPGAVDVSEQEELDRVVPVVEALARRFDAWISIDTSKAIVMQESAKVGAHMINDIRSL
QEFGALDAAVKTGLPVCLMHMQGQPSTMQAEPYYEDAVWETKTFLTRQIDRCVAAGIAKN
KLILDPGFGFGKNLSHNYQLLAHLEEFHHLGLPILAGMSRKSMIGQLLHVPPQECVTGSI
ACAVIAAMQGAQIIRVHDVKETVQTMQIVQATLSAKNILAVKNTL
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgacagccagaggcagtgtcctcgatctttcccgtccacaagtaatggggatt
ctgaacgttactcctgattctttttcagatggaggcaatcacagtacctttgatgccgcg
ttgcggcacgcagccacaatgatcgaggaaggtgcagccattattgatgtgggtggagaa
tcgacacgccctggtgccgtggatgtgagtgagcaggaagaactggatcgcgttgtcccc
gtggttgaagcactggcgcggcgttttgatgcatggatctccatcgatacctcaaaagcc
atagtgatgcaggaatctgctaaagtcggggctcatatgatcaatgatattcgttcgttg
caggagtttggtgcacttgacgcagcagtaaagacgggattgcctgtttgcctgatgcac
atgcagggacaacccagcactatgcaggcagagccatactatgaagatgccgtttgggaa
accaaaacatttttgacgaggcaaattgatcgctgtgttgcggcaggcatcgcaaaaaac
aaactgatccttgatccaggcttcggcttcgggaagaacttatcgcataattatcagcta
ttggctcatttggaagaattccatcatcttggcttgcctattctggctggaatgtcacgc
aaatcaatgattggccaattacttcatgtaccaccgcaggagtgtgtaacaggaagtatc
gcctgcgctgtgattgcagcgatgcaaggtgcccagattattcgtgtgcatgatgtaaaa
gaaaccgtacagacaatgcaaattgttcaggcaacactgtcagcgaaaaacatactggct
gtcaagaacacgctgtga

DBGET integrated database retrieval system