KEGG   Xenorhabdus bovienii: XBJ1_0363Help
Entry
XBJ1_0363         CDS       T01186                                 

Gene name
folP
Definition
7,8-dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
xbo  Xenorhabdus bovienii
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:xbo00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
369373..370230
Genome map
AA seq 285 aa AA seqDB search
MKLTARGSVLDLSRPQVMGILNVTPDSFSDGGNHSTFDAALRHAATMIEEGAAIIDVGGE
STRPGAVDVSEQEELDRVVPVVEALARRFDAWISIDTSKAIVMQESAKVGAHMINDIRSL
QEFGALDAAVKTGLPVCLMHMQGQPSTMQAEPYYEDAVWETKTFLTRQIDRCVAAGIAKN
KLILDPGFGFGKNLSHNYQLLAHLEEFHHLGLPILAGMSRKSMIGQLLHVPPQECVTGSI
ACAVIAAMQGAQIIRVHDVKETVQTMQIVQATLSAKNILAVKNTL
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgacagccagaggcagtgtcctcgatctttcccgtccacaagtaatggggatt
ctgaacgttactcctgattctttttcagatggaggcaatcacagtacctttgatgccgcg
ttgcggcacgcagccacaatgatcgaggaaggtgcagccattattgatgtgggtggagaa
tcgacacgccctggtgccgtggatgtgagtgagcaggaagaactggatcgcgttgtcccc
gtggttgaagcactggcgcggcgttttgatgcatggatctccatcgatacctcaaaagcc
atagtgatgcaggaatctgctaaagtcggggctcatatgatcaatgatattcgttcgttg
caggagtttggtgcacttgacgcagcagtaaagacgggattgcctgtttgcctgatgcac
atgcagggacaacccagcactatgcaggcagagccatactatgaagatgccgtttgggaa
accaaaacatttttgacgaggcaaattgatcgctgtgttgcggcaggcatcgcaaaaaac
aaactgatccttgatccaggcttcggcttcgggaagaacttatcgcataattatcagcta
ttggctcatttggaagaattccatcatcttggcttgcctattctggctggaatgtcacgc
aaatcaatgattggccaattacttcatgtaccaccgcaggagtgtgtaacaggaagtatc
gcctgcgctgtgattgcagcgatgcaaggtgcccagattattcgtgtgcatgatgtaaaa
gaaaccgtacagacaatgcaaattgttcaggcaacactgtcagcgaaaaacatactggct
gtcaagaacacgctgtga

DBGET integrated database retrieval system