KEGG   Xenorhabdus bovienii: XBJ1_0517Help
Entry
XBJ1_0517         CDS       T01186                                 

Gene name
fadB
Definition
multifunctional 3-hydroxybutyryl-CoA epimerase, delta(3)-cis-delta(2)-trans-enoyl-CoA isomerase, enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase (EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8)
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
xbo  Xenorhabdus bovienii
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:xbo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XBJ1_0517 (fadB)
   01212 Fatty acid metabolism
    XBJ1_0517 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    XBJ1_0517 (fadB)
   00650 Butanoate metabolism
    XBJ1_0517 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    XBJ1_0517 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    XBJ1_0517 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XBJ1_0517 (fadB)
   00310 Lysine degradation
    XBJ1_0517 (fadB)
   00380 Tryptophan metabolism
    XBJ1_0517 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    XBJ1_0517 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    XBJ1_0517 (fadB)
   00281 Geraniol degradation
    XBJ1_0517 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    XBJ1_0517 (fadB)
Enzymes [BR:xbo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     XBJ1_0517 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     XBJ1_0517 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     XBJ1_0517 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     XBJ1_0517 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(518206..520392)
Genome map
AA seq 728 aa AA seqDB search
MLYLSDTIQVNWLKDGIAELIFNAPAAINKLDTKTVASLDKAVAVLEQQTKLKGLLLRSE
KQAFIVGADITEFLSLFDAPKEKLQEWLKFANDIFSRIEDLPVPTISAINGYALGGGCEV
VLSTDFRVASPDLRIGLPETKLGIIPGFGGSVRLPRLIGPDNALEIITAGKDIGAEEALK
NGLIDAVVPTEKLVDAAVSILELAIKGDLDWQAARQPKLSPLNLNDVERTMSFTVAKGMV
MKVAGPHYPAPITAVKTIEKAATLGRDEALKLEAESFVPLAHTTVARALVGIFLNDQYVK
GLAKKHLKEVTVPQHATILGAGIMGGGIAYQSARKGVPVLMKDINQKALDLGVNEAAKLL
HKQFERGRLDAMKMAKILSSIQPTLSYAGIEQSQIVVEAVVENPKIKAAVLAETESHIND
DCILASNTSTIPITELAKSLKRPENFCGMHFFNPVHRMPLVEIIRGEKTSDKTISTVVAY
ASKMGKTPIVVNDCPGFFVNRVLFPYLAGFGMLLRDGGDFRQIDKIMEKEFGWPMGPAYL
IDVVGIDTAHHAQAVMAQGFPERMTRDYHDAIDVLFENQRYGQKNDVGFYKYTQDKKGKP
KKEQDETVDQLLAGISHPKQIFSGEDIIARTMIPMINEVVRCLEEGVIASPAEADMALVY
GLGFPPFHGGVFRYLDTMGTAAYVKLAERYAHLGAMYHVPAGLKAKSESNESYYPAAAKI
AVNPGEKA
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgctctacctaagtgacactattcaagtaaactggctgaaagatggcattgcagaactg
atattcaatgcaccagctgcaattaataaattagatacaaagaccgttgcttcattggat
aaagctgttgccgtccttgagcaacaaactaaattaaaagggctgttgctacgttctgaa
aaacaagcctttattgttggtgcagacatcacagaattcttatcattattcgatgcacca
aaagaaaaacttcaggaatggctgaagttcgccaatgatattttcagccgtattgaagat
ctccctgttcctactatttctgcgatcaacggctatgcacttggcgggggttgtgaggta
gtgctgtcaactgactttcgtgttgcatccccagatcttcgcatcggattacccgaaact
aaattaggcattatcccgggctttggtggctctgttcgcctgccacgtttaattggccca
gataacgctctagaaattatcaccgcaggtaaagatattggtgctgaagaagcgttgaaa
aatggtctgattgacgccgttgtgccgactgaaaagctggtagatgctgctgtttctatt
ctggaactggccatcaaaggcgatctggattggcaagctgcccgccaacctaaactttcc
ccactgaacctcaatgatgttgaacgcaccatgagcttcaccgtggcgaaaggaatggtg
atgaaagtcgcaggtccacattatccagcgccaattactgctgtaaaaactattgaaaaa
gcagcgacattgggtcgcgatgaagccttgaaactagaagcagaaagttttgttccactg
gctcataccactgttgcccgtgccttggtcggcatcttcctgaatgaccaatatgtcaaa
ggtctggcgaaaaagcatctgaaagaagtcacagtgccacaacatgcaacgatactgggt
gcaggtattatgggtggtggtatcgcctatcaatctgcacgcaaaggcgttcctgttctg
atgaaagacattaatcagaaagcgctggatttaggtgtcaatgaagccgctaagttattg
cataagcaatttgagcgtggacgtctggatgctatgaaaatggctaagattctgtcatcc
attcagccaacactcagttatgcgggcattgagcaatctcagattgttgtcgaagccgtt
gttgagaacccgaagatcaaagctgcggtcttggcagaaacggaatcacatatcaacgat
gattgcattctagcctccaatacctccacgatcccaatcactgaattggcaaaatcattg
aaacgtccggaaaatttctgtggtatgcattttttcaatccagttcaccgtatgccgctg
gttgaaatcatccgtggagaaaaaacctcagacaagaccatttctactgttgtggcttac
gccagcaaaatgggaaaaacaccgattgttgtcaatgattgcccaggctttttcgtcaac
cgcgtattgtttccttatctggcaggcttcggcatgttactgcgtgatggcggtgatttc
cgtcaaatcgacaagatcatggagaaagagtttggctggcctatgggtcccgcgtatctc
atcgacgttgttggcattgataccgcccatcatgctcaagctgtcatggcacaaggtttt
ccagagcgtatgactcgcgattatcacgatgccattgatgtattatttgaaaatcagcgt
tacggccagaaaaatgacgtaggtttctataaatacacccaagacaaaaaaggcaagccg
aaaaaagagcaagatgaaaccgtcgatcaactgctggcaggtataagtcacccgaaacaa
attttctctggtgaagatatcattgcccgtaccatgatcccaatgattaacgaagtcgtt
cgctgcttggaagaaggtgtcattgccagtcctgcagaagcagatatggcgctggtttat
ggtttaggcttcccgccattccacggtggtgttttccgctatctggatacgatgggaacc
gcagcttatgtgaaactggctgaacgttatgcccacttaggcgcaatgtatcacgttccc
gctggcctgaaagcgaaatccgaaagcaatgaaagttactaccctgccgcagccaaaatt
gctgttaatccaggtgaaaaagcgtga

DBGET integrated database retrieval system