KEGG   Xenorhabdus bovienii SS-2004: XBJ1_0593Help
Entry
XBJ1_0593         CDS       T01186                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
xbo  Xenorhabdus bovienii SS-2004
Pathway
xbo00900  Terpenoid backbone biosynthesis
xbo01100  Metabolic pathways
xbo01110  Biosynthesis of secondary metabolites
xbo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xbo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    XBJ1_0593 (dxr)
Enzymes [BR:xbo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     XBJ1_0593 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: CBJ79737
UniProt: D3UWG3
Position
610014..611210
Genome map
AA seq 398 aa AA seqDB search
MKRLTILGSTGSIGKSTLSVVRNNLDKFQVVALVAGKNIEIMAQQCLEFRPQYAAMADAH
SATVLRQLLQEQGSQTEVLSGREAICDLAALDDVDQVMSAIVGVAGLLPTLAAIRKGKQV
LLANKEALITSGRLFMQAVNQYQAQLLPIDSEHNAIFQSLPESVQHNLGNASLKQHGISS
IILTGSGGPFRRTPLETLLDVTPDEACAHPVWSMGRKISVDSATMMNKGLEYIEARYLFN
ASADEIEVLLHPQSVIHSMVRYQDGSIIAQLGTQDMCTPIAYAMAYPNRIVSGVKPLDFT
ELSTLTFEALDYRRYPCLKLAIDACHEGQAATTALNAANEETVSAFLKDGIRFTDIAMIN
RLVVEKLNLPEPESIEEVLEIDKVARELAKETIKACSK
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcttaactatccttggctcaacgggctcgattgggaaaagtaccctttctgtt
gtcagaaataacctggataaattccaagttgtggcactcgtcgctgggaaaaatattgaa
atcatggcacagcagtgtctggagtttcgtcctcaatatgcggcaatggcggatgcgcac
tcagcaacggtattacggcagttattacaggagcagggaagccagacagaagtgttatcc
ggtagggaagccatttgtgatttagctgcgttggatgatgttgatcaagtcatgtccgcg
attgtcggtgttgccgggttattgccgacgctggcggctatccgcaaaggtaagcaagtc
ttgttggccaacaaagaagcactcattaccagtgggcgtttgttcatgcaggcggtgaat
caatatcaagcgcaactgttgcccattgatagtgaacataatgccatcttccagagcttg
cctgaatctgttcagcacaatcttggaaatgcaagcttaaaacaacatggtatctccagt
attatcctgacgggatcaggtgggccgttccgcagaacccctctggagacattgcttgat
gtcacacctgatgaagcctgtgctcaccccgtctggtctatgggacgcaaaatttctgtt
gattccgcaaccatgatgaacaaagggctggaatatatcgaagctcgttacctgttcaat
gcctctgctgatgaaattgaagtgctgctccatcctcaatcagtaatccattcgatggtt
cgttatcaggatggcagcatcattgctcagttaggaacgcaggatatgtgtaccccaata
gcttatgcaatggcttatcccaatcgtatcgtttctggcgtaaaacctctggattttact
gaactgagcacactcacttttgaagcgttggattatcggcgttatccttgtctgaaactg
gccattgatgcttgccatgaaggtcaggcggcaacaaccgcgttgaatgccgccaatgaa
gaaacggtcagtgctttcttgaaagatgggatccgcttcactgatatcgcgatgattaat
cggttggtcgtcgaaaaattaaatttacctgaacctgaaagcatcgaagaggtcttagaa
atcgataaagtcgctagagaattagcaaaagaaacgattaaggcctgctccaaatag

DBGET integrated database retrieval system