KEGG   Xenorhabdus bovienii: XBJ1_0917Help
Entry
XBJ1_0917         CDS       T01186                                 

Gene name
hisD
Definition
bifunctional HisD: L-histidinal:NAD+ dehydrogenase/L-histidinol:NAD+ dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
xbo  Xenorhabdus bovienii
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:xbo01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:xbo00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
925690..927006
Genome map
AA seq 438 aa AA seqDB search
MSINFKTVIRWQECPPEQQKALLTRPAVVASENISRTVKQILETVKANGDEALQEFSQRF
DKTTIDTIPLSTSEVNAAASRLTPEIKQAMQQAMNNIRLFHEAQKPAVIEVETLPGVRCQ
QVTRPIDSVGLYIPGGSAPLPSTVLMLGIPAGIAECRNVILCSPPPIADEILYAAQLCGI
NEIFQVGGAQAIAAMAFGTESVPKVDKIFGPGNAWVTEAKRQVSQRFDGAAIDMPAGPSE
VLVIADSGANPAFTAADLLSQAEHGPDSQVVLVTPDEIFAEQVIREIETQLTALPRQQIA
IQALQSSRIIVTDNLTQCVAISNQYGPEHLIIQTRQPEQLVEKITSAGSVFLGDWSPESA
GDYASGTNHVLPTYGYTSTYSSLGLADFLKRMTVQQITPQGLRSLAPIIETLAQAEQLTA
HKNAVTLRIAALNNSDVE
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcaattttaagaccgttatccgctggcaggaatgcccaccagaacagcaaaaa
gcgttgctgacacgccctgctgtcgtcgcttcagaaaatatttcccgcacggtaaaacag
attctggaaacggtcaaagccaacggcgatgaagcattgcaggaattcagccaacgcttc
gacaaaacaacaatcgatactatcccgctttctacaagtgaagttaacgcagccgccagc
cgcctgacaccagaaatcaaacaggctatgcagcaggccatgaataacattcgcctgttc
catgaagcccaaaaacccgctgtgattgaggttgaaaccctgccgggtgttcgctgccag
caagtcacacgcccaatcgattctgtggggttatatattcccggaggttctgcgcctctg
ccttccactgtattaatgctgggaatacccgctggcatcgcagagtgccgtaacgttatt
ctgtgctccccacccccgattgccgatgaaattctctatgccgcacagctctgcgggatt
aacgaaatatttcaggttggcggcgcacaagccatcgcagcaatggcttttggcacagaa
tccgttcctaaagtggacaagatttttggcccgggtaatgcatgggtaacagaggctaaa
cggcaagtgagtcagcgcttcgacggtgcagccatagatatgccagcaggtccatcagaa
gtactggtaatagcggacagtggagccaatcccgcatttacggcagcagatctgctttca
caagcagagcatggccctgattctcaagtcgtgctggtcacacctgacgaaatttttgcc
gagcaggtgatccgtgaaatcgaaacccaacttacggccctgccacgccagcaaatcgcg
attcaggctctgcaatccagccggattatcgtcactgacaatctgacccaatgtgtagcg
atcagcaatcaatacggccctgaacacttaattatccaaacccgtcagcctgagcagctt
gtggaaaaaatcaccagcgcaggttcggttttcctcggagactggtcgccagaatccgca
ggagactatgcttcaggcaccaatcacgtcttgccgacctatggttatacttcaacctat
tccagcctcggtctggcagatttcctgaaacgaatgacggttcagcaaattacaccgcaa
ggattaagaagcctcgctccaatcatcgaaacactggcgcaggcagaacaactcaccgcg
cacaaaaatgccgtcacattacgcatagctgccctgaataactcagatgttgaataa

DBGET integrated database retrieval system