KEGG   Xenorhabdus bovienii: XBJ1_1038Help
Entry
XBJ1_1038         CDS       T01186                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
xbo  Xenorhabdus bovienii
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:xbo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XBJ1_1038 (gpmA)
   01230 Biosynthesis of amino acids
    XBJ1_1038 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XBJ1_1038 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    XBJ1_1038 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XBJ1_1038 (gpmA)
Enzymes [BR:xbo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     XBJ1_1038 (gpmA)
Exosome [BR:xbo04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   XBJ1_1038 (gpmA)
  Exosomal proteins of melanoma cells
   XBJ1_1038 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1032502..1033254
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESEWNKENRFTGWTDVELSDKGRTEAQQAGQLLKQEGFAFDFAYTSVL
KRAIHTLWNILDQVDQQWLPVEKNWKLNERHYGALQGLDKAETAAKYGDDQVKLWRRGFA
ITPPDLAKDDERYPGHDPRYANLKPEELPATESLAATIERVVPYWEDVIKPRVANGEKII
IAAHGNSLRALVKYLDGMSEEEILELNIPTAVPLVYEFDENMRPIKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaaactggttcttgtaaggcacggagagagcgagtggaacaaagagaac
cgttttactggctggactgatgttgagttgtctgacaaaggccgtactgaagcacaacag
gcgggtcaattactgaaacaagaaggtttcgcttttgatttcgcttacacttctgtttta
aaacgtgctattcacactttgtggaacattctggaccaagtcgatcaacaatggctaccg
gttgagaaaaactggaaactgaatgaacgccactatggcgcactgcaaggtctggataaa
gctgaaactgccgctaagtacggggatgatcaagttaaattgtggcgccgtggcttcgcg
attactccaccagatttggctaaagatgatgaacgttatcctggccacgatcctcgttac
gcgaacttaaaaccagaagaacttcctgccacagaaagccttgcagccacgattgagcgt
gttgttccttattgggaagacgttatcaaacctcgtgttgcaaatggtgaaaaaattatc
atcgctgctcacggcaactctctgcgtgctttagtgaaatatttggatggtatgagtgag
gaagaaattcttgagctgaatatcccaactgctgtgccgctggtttatgagtttgatgaa
aacatgcgacctatcaagcactattatctgggcaatgctgacgagatcgctgcaaaagca
gccgctgtagcaaaccaaggtaaagcgaaataa

DBGET integrated database retrieval system