KEGG   Xenorhabdus bovienii SS-2004: XBJ1_1060Help
Entry
XBJ1_1060         CDS       T01186                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with SdhC
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
xbo  Xenorhabdus bovienii SS-2004
Pathway
xbo00020  Citrate cycle (TCA cycle)
xbo00190  Oxidative phosphorylation
xbo00650  Butanoate metabolism
xbo01100  Metabolic pathways
xbo01110  Biosynthesis of secondary metabolites
xbo01120  Microbial metabolism in diverse environments
xbo01130  Biosynthesis of antibiotics
xbo01200  Carbon metabolism
Module
xbo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xbo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
xbo_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:xbo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XBJ1_1060 (sdhD)
   00650 Butanoate metabolism
    XBJ1_1060 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    XBJ1_1060 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Fumarate_red_C
Motif
Other DBs
NCBI-ProteinID: CBJ80201
UniProt: D3UX89
Position
complement(1054443..1054790)
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRTGIQDWLLLRASAIVIVLYVLYLVGFVATTSDITYEVWRSFFSSSLTKVF
TVLALLSILVHAWIGMWQVLTDYVKPLALRLVLQLVIIVALLVYLIYGTIVVWGA
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcatccgcattgggtcgcacgggtattcaggactggctgctgctgcgt
gcatctgcaatcgttattgttttatacgtcctttaccttgttggttttgtagcaacaacg
tcagacatcacctatgaagtctggcgcagtttcttctcttcatctctcactaaagtgttc
accgtgctggctctgctttctatcctggttcacgcatggatagggatgtggcaggtgctg
acggattatgtcaagccactcgcactgcgtttagtgctgcaactggtcattattgttgcg
ttgttggtttatttgatttacggaacaattgttgtgtggggtgcataa

DBGET integrated database retrieval system