KEGG   Xenorhabdus bovienii: XBJ1_1258Help
Entry
XBJ1_1258         CDS       T01186                                 

Definition
lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
xbo  Xenorhabdus bovienii
Brite
Enzymes [BR:xbo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     XBJ1_1258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1249514..1249948
Genome map
AA seq 144 aa AA seqDB search
MEISNKGLECIKQYEGLKLKVYPDPATGGIPWTIGYGHTKGVKKGDVITEQQAEAFLQDD
LQPVYTTLRQWVNVPLNQGQFDALCSFIFNCGSGNFSGSTLLKKLNQGDYKGAAAEFSRW
NKAAGKAMRGLDNRRASERQMFLS
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcagcaataaaggccttgagtgtatcaaacagtatgaaggcctgaaactgaaa
gtctaccccgatcccgcaactggcggcattccgtggacaattggttacggtcataccaaa
ggggttaaaaaaggtgatgtgattacagagcagcaggctgaagcattcttgcaggatgat
ctccagcctgtttacaccacattaaggcaatgggttaacgttcctttgaatcaaggccag
ttcgatgctttgtgctcgtttatcttcaattgcggtagcggtaacttttctggctctact
ttattaaagaaactcaatcaaggtgattataaaggcgcagcggcagaattttcccgctgg
aataaagcagcaggtaaggcaatgcgtgggctggataatcgcagggcatctgaacgccag
atgtttttatcatga

DBGET integrated database retrieval system