KEGG   Xenorhabdus bovienii: XBJ1_1387Help
Entry
XBJ1_1387         CDS       T01186                                 

Gene name
ydfQ
Definition
Qin prophage; lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
xbo  Xenorhabdus bovienii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1352829..1353368)
Genome map
AA seq 179 aa AA seqDB search
MQDIKTRFSRVIIGLIIGGASSSVILSQFLDEKEGNRLSAYRDGGGIWTICRGVTRIDGK
AVYKGMKLAPEQCDVLNRIEADRAIDWVKKNVRVPLTDPQIAGIASFCPYNIGPGKCFSS
TFYRKLNAGDKKGACAEIKRWVYDGGRDCRKTQGQPNGCYGQVLRRDQEAELVCWGLDK
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgcaggatatcaaaaccaggttcagccgagtgatcattggccttattattggtggtgct
agctcttctgtcattctttctcaatttttggatgagaaagaaggcaaccgactgtctgcc
tatcgagatggcggcggcatctggacaatatgtcgcggcgtgacgcgcattgatggcaaa
gcggtatataaaggaatgaagctagcgcctgaacaatgtgatgttttgaaccgaatcgaa
gccgacagggcgattgattgggtgaaaaagaatgtgcgcgttccgctgactgacccgcaa
attgccggtattgccagtttctgtccgtataacatcggccccggaaaatgcttttcctcc
actttttatcgcaaactcaacgccggcgataaaaaaggtgcgtgtgcagagatcaaacgc
tgggtctatgatggtgggcgtgactgccgaaaaactcaagggcagccgaatggctgttat
ggtcaggttctgcggcgtgatcaagaagctgaactggtgtgttgggggctggataaatga

DBGET integrated database retrieval system