KEGG   Xenorhabdus bovienii: XBJ1_1449Help
Entry
XBJ1_1449         CDS       T01186                                 

Gene name
speB
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
xbo  Xenorhabdus bovienii
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xbo00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    XBJ1_1449 (speB)
Enzymes [BR:xbo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     XBJ1_1449 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1418457..1419383
Genome map
AA seq 308 aa AA seqDB search
MSISSLGNQIDNSLVSNAFGFLRFPLNFQPYSSDAEWVITGVPFDMATSGRAGSRHGPAA
IRQVSTNLAWESCRWPWDFSLRKRLNVVDCGDLVFNFGDAQDMSDKLQAHAEKVLASGKK
MLSFGGDHFVTLPLLRAHAKHFGKMALIHFDAHTDTYPNGSKFDHGTMFYHAPNEGLIDP
HRSVQIGIRTEHDTDNGFTVLDAAQVNDRSVDAVVEQIKNVVGDLPIYLTFDIDCLDPAF
APGTGTPVIGGLTSDRALKILRGLQPLNIVGMDVVEVAPAYDQSEITALAAATIGLELLY
LQASKKAV
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagtattagctccttagggaaccaaattgataactctttggtttcaaatgccttcggt
ttcctgcgctttccgctgaatttccagccttattccagtgatgcagaatgggtgattacc
ggtgtgccttttgatatggcaacatctgggcgtgccggcagccgtcatgggccagccgct
attcgtcaggtatcgactaatctggcgtgggaaagctgtcgctggccgtgggacttcagc
ttgcgcaaacgcctgaatgtggtggattgcggtgatctggtctttaacttcggtgatgct
caggacatgagcgacaagttgcaggcacatgctgaaaaagtgctggcatcgggtaagaaa
atgctgtctttcggcggtgatcattttgtcactttgccattactgcgcgcccatgctaaa
catttcggcaaaatggcactgattcattttgatgctcatacggacacctatccgaatggc
agcaagtttgatcatggtacgatgttttatcatgcacctaacgaagggctaatagatcct
catcgttcggtgcaaatcggtattcgcaccgaacacgatactgacaatggttttactgta
ttggatgcggcacaggtcaacgatcgtagcgttgatgctgttgttgaacaaatcaaaaac
gttgtcggtgatctgccaatttacctgacattcgatattgattgccttgatcctgctttt
gcgcccggtacagggacgccagtgattggcgggttgacgtctgatcgtgcactgaaaatc
ctgcgtggtctgcaacccctgaatatcgtcggcatggatgtggtggaagtggctcctgcc
tatgatcagtctgaaatcaccgctctggcagcagcgacgattggattggaattgctgtat
ttgcaggcgtcgaaaaaagcagtttag

DBGET integrated database retrieval system