KEGG   Xenorhabdus bovienii: XBJ1_1609Help
Entry
XBJ1_1609         CDS       T01186                                 

Gene name
recR
Definition
gap repair protein
Orthology
K06187  
recombination protein RecR
Organism
xbo  Xenorhabdus bovienii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:xbo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    XBJ1_1609 (recR)
DNA repair and recombination proteins [BR:xbo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      XBJ1_1609 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1570954..1571562)
Genome map
AA seq 202 aa AA seqDB search
MQTSPLLESLMESLRCLPGVGPKSAQRMAFHLLQRDRSGGMRLAQALTRAMSEIGHCQDC
RTFTEQEQCTICGNPRRQQNGQICVVETPADIHAIEQTGQFAGRYFVLMGRLSPLDGIGP
MDIGLDRLEERLSSETLSEIILATNPTVEGEATANYIAEMCSQYGVIASRIAHGVPVGGE
LEMVDGTTLSHSLAGRQRITDL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagtcctcttcttgaatccctgatggagtcattacgctgtttacccggtgta
ggtcccaaatcagcccagcgaatggcatttcatttgttgcaacgggatcgcagtggtggc
atgaggcttgctcaggcattgactcgtgcaatgtctgaaattggtcactgtcaggactgc
cggacatttactgaacaggaacaatgcacgatttgtggtaatccccgtcgtcagcagaat
ggtcagatctgtgtggtggaaacgcctgcggatattcacgccattgaacagaccggccag
tttgccggtcgttattttgtcctgatggggcgcttatcgccgctggatggtatcgggcca
atggatattggtttggatcgtttggaagaacgtctgtcttccgaaaccctgtcagaaatt
attctggccaccaacccgactgttgaaggagaggcaacggcaaactatatcgcggaaatg
tgttcgcaatatggtgtgatagccagtcgtattgctcatggtgttcccgtggggggggaa
cttgaaatggtggatggtacaacgttgtcccattcacttgcgggtcgtcaaagaatcact
gatttgtga

DBGET integrated database retrieval system