KEGG   Xenorhabdus bovienii: XBJ1_1797Help
Entry
XBJ1_1797         CDS       T01186                                 

Gene name
rluA
Definition
23S rRNA pseudouridylate 746 synthase (EC:4.2.1.70)
Orthology
K06177  
tRNA pseudouridine32 synthase / 23S rRNA pseudouridine746 synthase [EC:5.4.99.28 5.4.99.29]
Organism
xbo  Xenorhabdus bovienii
Brite
Enzymes [BR:xbo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.28  tRNA pseudouridine32 synthase
     XBJ1_1797 (rluA)
    5.4.99.29  23S rRNA pseudouridine746 synthase
     XBJ1_1797 (rluA)
Transfer RNA biogenesis [BR:xbo03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    XBJ1_1797 (rluA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1754419..1755072
Genome map
AA seq 217 aa AA seqDB search
MLESYNPPTDPWLHVLYQDEHIMVVNKPSELLSVPGKAEDHKDSIMTRIQAEFPTAESVH
RLDMATSGVMVVALTKAAERELKRQFREREPKKVYIARVWGKLEREKGLVDLPLICDWPN
RPKQKVCFETGKSAQTEYQVLEYEAQATRVRLAPITGRSHQLRVHMLALGNPILGDRFYA
HQQARELAPRLQLHAQELSITHPAYGTPMHFECKADF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgctggaatcttataatcccccgactgatccctggttacacgtgctttatcaagacgag
cacattatggtcgttaataaacccagtgagttgctttctgtaccgggcaaagcagaggac
cataaggacagtatcatgacgcggatacaggccgagtttccaacggctgaatctgttcat
cgactagatatggcaaccagtggtgtcatggttgttgcactgaccaaagcggctgaacgt
gagctaaaacgtcagtttcgtgaacgtgagccgaaaaaagtctatatcgcccgggtatgg
ggaaaattagaacgggaaaaaggtctggtagatttaccactgatctgcgactggccgaac
cgcccgaagcaaaaggtctgttttgaaaccggaaaatcggcacagacagagtatcaagtg
ctggaatatgaagctcaggccactcgcgtcaggcttgctcccatcactgggcgatcccat
cagctacgtgtacatatgctggcgcttggcaaccccattctgggggacaggttctatgct
catcagcaggcaagagaactggcacctcgcctgcaattacatgcacaagagttgtcgatt
actcacccggcctacggcactccgatgcattttgaatgcaaggccgatttttga

DBGET integrated database retrieval system