KEGG   Xenorhabdus bovienii: XBJ1_1922Help
Entry
XBJ1_1922         CDS       T01186                                 

Gene name
cheW
Definition
purine-binding chemotaxis protein; regulation
Orthology
K03408  
purine-binding chemotaxis protein CheW
Organism
xbo  Xenorhabdus bovienii
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:xbo00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    XBJ1_1922 (cheW)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    XBJ1_1922 (cheW)
Bacterial motility proteins [BR:xbo02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    XBJ1_1922 (cheW)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1857202..1857699
Genome map
AA seq 165 aa AA seqDB search
MSAIEEFSKLSGETTGKEYLVFTLGDEEYGIEILKVQEIRGYDQVTRIANTPSFIKGITN
LRGVIVPIIDLRIKFSQENVTYNDNTVVIVLNLLNRVVGIVVDGVSDVLSLKDDQICPAP
EFAVTLSTEYLTGLGSIDERMLILVDIEKLLNSEEMALVDSVAKS
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccatagaagaattcagtaaattatcgggggaaacaaccggaaaggaatatctg
gttttcaccttgggtgacgaagagtatggaattgaaatactgaaagtgcaggaaatacgc
ggttacgaccaagttacccggattgcaaatacaccttcttttatcaaagggataaccaat
ctgcgtggggtgatagttcccattattgacttgaggatcaaattctcgcaggaaaacgtc
acttataacgacaacaccgtcgtgattgtcctgaacctgcttaatcgtgtggtgggaatt
gtggtcgatggtgtgtccgatgtgctgtctctgaaggacgatcaaatttgtccagcgccg
gagtttgcggttaccttgtcaactgaatatctgacagggttaggttccattgatgaacga
atgctgattctggtagatatcgaaaaactcctgaacagtgaagaaatggcattggtggat
tctgtcgctaagagctga

DBGET integrated database retrieval system