KEGG   Xenorhabdus bovienii: XBJ1_1922Help
Entry
XBJ1_1922         CDS       T01186                                 

Gene name
cheW
Definition
purine-binding chemotaxis protein; regulation
Orthology
K03408  
purine-binding chemotaxis protein CheW
Organism
xbo  Xenorhabdus bovienii
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:xbo02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:xbo02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1857202..1857699
Genome map
AA seq 165 aa AA seqDB search
MSAIEEFSKLSGETTGKEYLVFTLGDEEYGIEILKVQEIRGYDQVTRIANTPSFIKGITN
LRGVIVPIIDLRIKFSQENVTYNDNTVVIVLNLLNRVVGIVVDGVSDVLSLKDDQICPAP
EFAVTLSTEYLTGLGSIDERMLILVDIEKLLNSEEMALVDSVAKS
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccatagaagaattcagtaaattatcgggggaaacaaccggaaaggaatatctg
gttttcaccttgggtgacgaagagtatggaattgaaatactgaaagtgcaggaaatacgc
ggttacgaccaagttacccggattgcaaatacaccttcttttatcaaagggataaccaat
ctgcgtggggtgatagttcccattattgacttgaggatcaaattctcgcaggaaaacgtc
acttataacgacaacaccgtcgtgattgtcctgaacctgcttaatcgtgtggtgggaatt
gtggtcgatggtgtgtccgatgtgctgtctctgaaggacgatcaaatttgtccagcgccg
gagtttgcggttaccttgtcaactgaatatctgacagggttaggttccattgatgaacga
atgctgattctggtagatatcgaaaaactcctgaacagtgaagaaatggcattggtggat
tctgtcgctaagagctga

DBGET integrated database retrieval system