KEGG   Xenorhabdus bovienii: XBJ1_1926Help
Entry
XBJ1_1926         CDS       T01186                                 

Gene name
cheB
Definition
chemotactic response regulator; methylesterase, in two-component regulatory system with CheA, regulates chemotactic response (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
xbo  Xenorhabdus bovienii
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:xbo02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:xbo02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1862240..1863208
Genome map
AA seq 322 aa AA seqDB search
MEVVDCAPDPFVARDLIKKHNPQVLTLDVEMPRMDGIDFLEKLMRLRPMPVVMVSSLTAK
GSEITLKALELGAVDFVTKPQLGLREGMLAYSELIAEKIRAAAQAKISTMPSSPVIATPL
NFKPLLSSEKLIAVGASTGGTEAIKNLLQPLPVTSPALLITQHMPPGFTRSFAERLNKLS
QITVKEAENGERVLPGHAYIAPGDHHMELCRSGANYQIMTTRAPPVNRHRPSVDVLFRSV
AKHAGRNAVGVILTGMGSDGAAGLLEMKQAGAYTLAQSEASCVVFGMPRAAIQLGAIDDI
MDIQKISKAMLAKISAGQSIRI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggaggtggtggactgcgcgccagatccgtttgttgcccgtgatttaataaaaaaacac
aatcctcaggtattaacactggatgtagagatgccacgcatggatggcattgattttctt
gaaaaattaatgcgtttgcgtcccatgccggttgtgatggtttcgtctctgacggcgaaa
ggatcagaaattacattgaaagcactggagctgggtgcggtcgattttgtgaccaagccg
caactgggccttcgcgaaggaatgctggcctatagtgagctgattgccgaaaaaatccgc
gctgcggcgcaggcaaaaatcagtaccatgccatccagtcctgtgattgctaccccattg
aatttcaagccactattatccagcgaaaaactgatcgcagtcggcgcttcgacaggggga
acagaggcaataaaaaacctgttgcaacctttgcctgtcaccagcccggcgttactgatc
actcagcatatgccgccgggttttacacgttcatttgcagaaaggctcaataaattaagc
caaatcaccgttaaagaggcggagaatggtgagcgggttctgccggggcatgcttacatc
gcaccgggggatcaccatatggaactgtgtcgtagcggagctaattatcaaatcatgact
acccgcgctccgccggtcaatcgtcatcgtccttccgttgatgtgctgttccgctccgtt
gccaaacatgcgggacgcaatgccgttggtgtcatcttgaccggaatgggtagtgatgga
gctgccggcctgctggaaatgaaacaggcaggtgcttatacgctggcacagagtgaagca
agctgcgtagtctttggtatgccacgagcggcgatccagctgggagctattgatgacatt
atggatattcaaaaaatcagtaaagcgatgctggccaaaatcagcgcagggcaatcgatt
cgtatttag

DBGET integrated database retrieval system