KEGG   Xenorhabdus bovienii: XBJ1_2266Help
Entry
XBJ1_2266         CDS       T01186                                 

Gene name
ruvA
Definition
Holliday junction helicase subunit A
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
xbo  Xenorhabdus bovienii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:xbo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    XBJ1_2266 (ruvA)
Enzymes [BR:xbo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     XBJ1_2266 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2242092..2242709
Genome map
AA seq 205 aa AA seqDB search
MIGRLRGTVLEKQPPLVLLETNGVGYEVHMPMTCFYELPEIGQEATLFTQFIVREDAQLL
YGFNDKQERALFRELIKVNGVGPKLALAILSGMSAQQFVTAIEQEAITSLVKLPGVGKKT
AERLVVEMKDRFKGLNGDLFNQSNDINLPAVAKQANSNTDIEAEAASALVSLGYKLQEAS
RMVSKVAKPGADCETLIREALRAAL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtgatagggcgtttgagaggaaccgtgttggaaaagcagccaccattagttttattagaa
accaatggtgtcggttatgaagttcatatgccaatgacctgtttttatgaactgcctgaa
atcggccaagaggctactttattcactcaatttattgtgcgtgaagatgctcagttatta
tacggttttaatgataaacaagagcgcgcactttttcgtgaactgattaaagttaatggc
gtagggccgaagctggcactggcgatcctgtcagggatgtctgctcagcaatttgtgact
gcgattgaacaggaagccattacctcattggtcaagttgccgggagtcggcaaaaaaacg
gccgaaaggctggttgtggaaatgaaagatcgctttaaaggccttaacggtgatctgttc
aaccaaagcaacgatattaatttacctgcggtggctaaacaagccaactctaatacggat
attgaagcagaagccgcttccgcattggtttcactgggatataaactgcaggaagccagc
cggatggtaagtaaggtggctaaaccgggcgcagattgtgaaacgcttattcgagaagcg
ctgcgtgcggctctgtag

DBGET integrated database retrieval system