KEGG   Xenorhabdus bovienii SS-2004: XBJ1_2275Help
Entry
XBJ1_2275         CDS       T01186                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta protein
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
xbo  Xenorhabdus bovienii SS-2004
Pathway
xbo00260  Glycine, serine and threonine metabolism
xbo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
xbo01100  Metabolic pathways
xbo01110  Biosynthesis of secondary metabolites
xbo01130  Biosynthesis of antibiotics
xbo01230  Biosynthesis of amino acids
Module
xbo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xbo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XBJ1_2275 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XBJ1_2275 (trpB)
Enzymes [BR:xbo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     XBJ1_2275 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CBJ81401
UniProt: D3V251
Position
complement(2247725..2248915)
Genome map
AA seq 396 aa AA seqDB search
MSKLNPYFGDFGGQFVPQILIPALDQLEEVFIEAQNDPEFQQTFQDLLKNYAGRPTALTL
CQNLTKGTKSRLYLKREDLLHGGAHKTNQVLGQALLAKRMGKNEIIAETGAGQHGVATAL
ACALLGLKCRIYMGAKDIERQSPNVFRMRLMGAEVIPVHSGAATLKDACNEAMRDWAGCY
DKAHYLLGTAAGPHPYPTIVREFQRMIGEEAKAQIMEKEGRLPDAVIACIGGGSNAIGLF
AEFIPETNVRLIGVEPAGHGIETGEHGAPLKHGKLGIYFGMKSPIMQTEDGQIEESYSIS
AGLDFPSVGPQHAYLNNIGRADYVSVTDDEAIDAFKALSHNEGIIPALESSHALAHALKM
IHQAPDKEQLLIVNLSGRGDKDIFTVHDILQSRGEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaactgaatccttattttggtgactttggtgggcagtttgttccccaaatcttg
atccccgcacttgatcagttagaagaagtatttattgaggcgcaaaacgatcctgaattt
caacaaacctttcaagatctactgaaaaactacgcaggccgtccgaccgccttaacctta
tgccagaacctgaccaaaggcacaaaaagtcgtctgtatttaaaacgggaagatttgctc
cacggtggtgcgcacaaaaccaatcaggtattaggacaggcattgctggcaaagcgaatg
ggtaaaaacgaaatcattgccgagactggagccggtcagcatggtgtggcaaccgcacta
gcctgtgcacttttggggctaaaatgccgtatttacatgggagccaaagatattgaacgc
caatcccccaatgtctttcgtatgcgtctgatgggcgctgaagtcattcctgttcacagt
ggtgccgcaaccctgaaagacgcctgcaacgaggccatgcgtgactgggctggttgctat
gacaaagcccattatttgctgggaaccgccgccggcccccatccttatccaacgatagtg
cgtgaatttcaacgaatgatcggcgaggaagccaaggcacagattatggaaaaagagggg
cgtttacccgatgccgttatcgcctgtattggcggcggctcaaatgccattggcctgttc
gctgaattcattccagaaactaatgttcgcctgattggtgtcgaaccggcaggacatggt
atcgaaaccggagaacatggtgcgccattgaaacatggcaagctagggatctacttcggc
atgaaatctccgatcatgcagacggaagacgggcaaattgaagaatcttactctatttcc
gccggcctggattttccttctgtcggcccccaacacgcttacctaaacaatattggacgc
gctgattatgtttcagtcactgacgatgaggcaattgacgcattcaaggctctgtcgcac
aacgaaggcatcattcccgcgttagagtcctcacatgcacttgcccacgccttgaaaatg
atccatcaggctcctgataaagaacaattattgattgttaatttatctggtcgtggcgac
aaagacatctttaccgtacacgatattttgcaatccaggggggaaatctga

DBGET integrated database retrieval system