KEGG   Xenorhabdus bovienii: XBJ1_2430Help
Entry
XBJ1_2430         CDS       T01186                                 

Gene name
adhE
Definition
multifunctional acetaldehyde-CoA dehydrogenase/iron-dependent alcohol dehydrogenase/pyruvate-formate lyase deactivase (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
xbo  Xenorhabdus bovienii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:xbo00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    XBJ1_2430 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XBJ1_2430 (adhE)
   00620 Pyruvate metabolism
    XBJ1_2430 (adhE)
   00650 Butanoate metabolism
    XBJ1_2430 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    XBJ1_2430 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    XBJ1_2430 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    XBJ1_2430 (adhE)
   00626 Naphthalene degradation
    XBJ1_2430 (adhE)
Enzymes [BR:xbo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     XBJ1_2430 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     XBJ1_2430 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2405872..2408526
Genome map
AA seq 884 aa AA seqDB search
MAVTQIAELNELIARVKKAQREFTNFSQEQIDRIFRAAALAAADARIPLAKLAVAESGMG
IVEDKVIKNHFASEYIYNAYKDDKTCGILSEDNTFGTITIAEPIGLICGIVPTTNPTSTA
IFKALISLKTRNGIIFSPHPRAKKATNRAAEIVLQAAVAAGAPKDIIGWIDEPSVELSNA
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDESADIKRAVASILMSKTF
DNGVICASEQSVIVVDNVYDQVRERFSTHGGYLLQGEELQAVQDIILKNGSLNAAIVGQP
ATKIAEMAGICVPDETKILIGEVTLVDETEPFAHEKLSPLLAMYRGKNFEDAVEKAEKLV
EMGGIGHTSSLYTDQDNQSERIEYFGDKMKTARILINTPASQGGIGDLYNFKLSPSLTLG
CGSWGGNSISENVGPKHLINTKTVAKRAENMLWHKLPKSIYFRRGSLPVALEEVATDGAK
RAFIVTDRFLFNNGYTDQVINVLKSHGIETEIFFEVEADPTLGIVRKGAEQMHLFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKMVAITTTSG
TGSEVTPFAVVTDDITGQKYPLADYALTPDMAIVDANLVMNMPKSLCAFGGLDAVTHALE
AYVSVLANEYSDGQALQALKLLKDFLPASYHEGAKNPVARERVHNAATIAGIAFANAFLG
VCHSMAHKLGSEFHIPHGLANALLICNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAE
HLGLTVSGDNTAAKIEKLLAWLEELKSQLGIPVSIRETGVQETDFLTKIDKLAEDAFDDQ
CTGANPRYPLISELKQLMLDSFYGREFTEYAISQEAEKPNRKNK
NT seq 2655 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactcagattgccgaactcaatgaattaattgctcgtgtaaaaaaagcccag
agagaattcaccaatttttcccaagaacaaattgaccgaattttccgtgcggctgctctc
gcggcagcagatgcccgtattccattggcaaagttagctgtagctgaatctggtatgggt
attgtggaagataaagtgatcaaaaatcacttcgcttctgaatatatttataacgcctat
aaagatgataaaacctgtggaattttatctgaagacaataccttcggtacgataaccatc
gctgaacctattggcttgatttgcggtattgttccaaccacaaatccaacgtcaaccgcg
attttcaaagcacttatcagcctgaaaacccgtaatggtattattttttcgccccatcca
cgcgccaaaaaagcaaccaatagggcagcagaaatcgttcttcaagctgctgttgcagcc
ggcgcaccaaaagatatcatcggttggatagatgaaccttctgttgaactatccaatgct
ttaatgcatcaccctgatattaatcttattttggcaacgggtgggcccggcatggtaaaa
gcagcctatagctcaggcaagcctgcaattggtgttggtgcgggtaatacgccagtggtg
atcgatgaatctgcggatatcaaacgcgccgtagcatcgatcctgatgtccaaaactttc
gataacggcgtaatttgtgcttctgagcaatctgtaattgtcgtcgataacgtttatgat
caagtccgtgaacgtttctcaacccacggtggttatctcctgcaaggagaggagcttcaa
gccgttcaagatatcattttaaaaaatggcagtctgaatgccgccatcgttggccaacct
gcaaccaagattgctgaaatggcaggtatttgcgttcctgatgaaactaaaattcttatc
ggtgaagtcactttggtggacgaaacagaaccttttgcccatgaaaaactttcgccactg
cttgctatgtaccgtggtaaaaactttgaagatgccgttgaaaaagcagaaaaactggtt
gaaatgggtggtattggtcacacctcctctctctatactgatcaggataatcaatccgaa
cgtatcgaatatttcggcgacaagatgaagactgcccgtattctgataaatacaccagca
tctcaggggggaatcggcgatctttacaatttcaaactctccccttctctaacactgggt
tgcggctcttggggaggaaactccatttccgaaaacgtggggccaaaacacctgatcaat
acgaaaactgtcgccaaaagagccgagaatatgttgtggcataaacttcccaaatcaatc
tattttcgccgtggctccctgcccgtagcactggaagaagttgctacagatggcgcgaaa
cgtgctttcatcgtgacagaccgtttcttgtttaataacggctacaccgatcaggttatc
aacgtattgaaatctcacggaatagaaactgagattttcttcgaagttgaagccgaccct
actttaggcatcgtccgcaagggcgccgaacaaatgcatctgtttaaacctgatgtcatc
attgccctaggagggggttcacctatggatgcagccaaaattatgtgggttatgtatgag
catccagaaactcactttgaagaattggcactgcgttttatggatatccgcaaacgcatt
tataaattccccaaaatgggcgtgaaagcaaaaatggtagcgattacaaccacctctgga
acaggttcagaggtaacaccttttgcggttgttaccgatgatatcactggacagaaatat
ccattggcagattatgcactgacacctgatatggcgattgtcgatgcaaaccttgttatg
aatatgccaaagtcgctgtgtgcctttggtggattggatgccgttacccatgcactcgaa
gcttatgtctctgtcttggctaatgaatactctgatggtcaagcattgcaagcgctgaag
ctattgaaggattttctgcctgccagttaccatgaaggtgctaaaaacccagttgcccgc
gaacgtgtccataatgcggcaaccattgccggaattgcctttgccaatgcttttctggga
gtctgccattctatggctcataaactgggctctgagttccatatcccacatggattggcg
aatgcgttgttgatctgtaacgttattcgctacaacgctaacgacaatccaacaaaacaa
actgcattcagtcaatatgaccgtccacaggcacgacgccgctatgctgaaattgcagag
catctggggttgacggtatcaggggataacactgccgccaagattgaaaaattactggct
tggctggaagagctaaaatctcaattaggtattccagtatcaattcgtgaaacaggcgtt
caggaaaccgattttctaacgaaaatcgataaactcgcagaagacgcttttgatgatcaa
tgcacaggcgccaacccgcgttatccactaatttctgagttgaagcaattgatgctggat
tctttttacggtcgtgaattcacagaatatgccatatctcaggaagcagaaaaaccaaac
agaaaaaataaataa

DBGET integrated database retrieval system