KEGG   Xenorhabdus bovienii: XBJ1_2435Help
Entry
XBJ1_2435         CDS       T01186                                 

Gene name
galU
Definition
glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
xbo  Xenorhabdus bovienii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xbo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    XBJ1_2435 (galU)
   00052 Galactose metabolism
    XBJ1_2435 (galU)
   00500 Starch and sucrose metabolism
    XBJ1_2435 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    XBJ1_2435 (galU)
Enzymes [BR:xbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     XBJ1_2435 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2412905..2413822)
Genome map
AA seq 305 aa AA seqDB search
MSIINKKIKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIKAGINEIILV
THSSKNSIENHFDTSFELEAILERRVKRQLLDEVQSICPNHVTIMQTRQGIAKGLGHAVL
CAKPLIGDEPFAVILPDVILDEYSTDLSKYNLSEMLSRFNSSGASQILVEPVPLESVADY
GVVDCLGENLQPGDSKPIARVVEKPKPEEAPSNLSIVGRYVLSEKIWPLLAKTAPGAGDE
IQLTDAIAMLMEKEPVEAYHLQGRSHDCGNKLGYMQAFVEYGMKHKDLGTAFKDWIMTLQ
NQIEK
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattataaacaaaaagataaaaaaagctgttatccctgttgctggtttgggaaca
agaatgttgccggcgaccaaagccattcctaaagaaatgctcccgctggttgataaacca
cttattcagtatgtcgttaatgaatgtattaaggcgggtattaatgaaattattctggtt
acgcattcatccaaaaactctatagaaaaccattttgataccagttttgaattggaagcg
atccttgaaaggagggtcaagcgccagttgctagatgaggtacaatcgatttgcccaaat
catgtgacaattatgcagacccgtcaggggatcgcaaaaggattgggccatgcggtgtta
tgtgctaagccactgattggtgatgaaccatttgctgttattctgccagatgtcattttg
gatgaatacagtacagatttgtcgaaatataatttgagtgaaatgttgtcacgctttaat
agcagtggagcgagccagatattggttgaacccgttcctttggaaagcgtcgcagattat
ggtgttgttgattgccttggcgaaaatctgcaacctggtgacagcaagcctattgctcgt
gttgttgaaaaacccaaaccggaagaagccccatcgaatctttccatcgttggtcgctat
gtgttgtctgaaaaaatctggccattattggcgaaaactgcaccgggtgcaggagatgaa
attcagctgacagatgccattgctatgctgatggaaaaagaacccgttgaagcttatcat
ttgcaaggccgcagtcatgattgtggtaataaattgggttatatgcaggcattcgtcgaa
tatggtatgaaacataaggacttaggtacagcattcaaggattggatcatgacattgcag
aatcagatcgaaaaataa

DBGET integrated database retrieval system