KEGG   Xenorhabdus bovienii SS-2004: XBJ1_2435Help
Entry
XBJ1_2435         CDS       T01186                                 

Gene name
galU
Definition
(GenBank) glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
xbo  Xenorhabdus bovienii SS-2004
Pathway
xbo00040  Pentose and glucuronate interconversions
xbo00052  Galactose metabolism
xbo00500  Starch and sucrose metabolism
xbo00520  Amino sugar and nucleotide sugar metabolism
xbo01100  Metabolic pathways
xbo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xbo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    XBJ1_2435 (galU)
   00052 Galactose metabolism
    XBJ1_2435 (galU)
   00500 Starch and sucrose metabolism
    XBJ1_2435 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    XBJ1_2435 (galU)
Enzymes [BR:xbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     XBJ1_2435 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3 DUF4833 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: CBJ81561
UniProt: D3V1L7
Position
complement(2412905..2413822)
Genome map
AA seq 305 aa AA seqDB search
MSIINKKIKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIKAGINEIILV
THSSKNSIENHFDTSFELEAILERRVKRQLLDEVQSICPNHVTIMQTRQGIAKGLGHAVL
CAKPLIGDEPFAVILPDVILDEYSTDLSKYNLSEMLSRFNSSGASQILVEPVPLESVADY
GVVDCLGENLQPGDSKPIARVVEKPKPEEAPSNLSIVGRYVLSEKIWPLLAKTAPGAGDE
IQLTDAIAMLMEKEPVEAYHLQGRSHDCGNKLGYMQAFVEYGMKHKDLGTAFKDWIMTLQ
NQIEK
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattataaacaaaaagataaaaaaagctgttatccctgttgctggtttgggaaca
agaatgttgccggcgaccaaagccattcctaaagaaatgctcccgctggttgataaacca
cttattcagtatgtcgttaatgaatgtattaaggcgggtattaatgaaattattctggtt
acgcattcatccaaaaactctatagaaaaccattttgataccagttttgaattggaagcg
atccttgaaaggagggtcaagcgccagttgctagatgaggtacaatcgatttgcccaaat
catgtgacaattatgcagacccgtcaggggatcgcaaaaggattgggccatgcggtgtta
tgtgctaagccactgattggtgatgaaccatttgctgttattctgccagatgtcattttg
gatgaatacagtacagatttgtcgaaatataatttgagtgaaatgttgtcacgctttaat
agcagtggagcgagccagatattggttgaacccgttcctttggaaagcgtcgcagattat
ggtgttgttgattgccttggcgaaaatctgcaacctggtgacagcaagcctattgctcgt
gttgttgaaaaacccaaaccggaagaagccccatcgaatctttccatcgttggtcgctat
gtgttgtctgaaaaaatctggccattattggcgaaaactgcaccgggtgcaggagatgaa
attcagctgacagatgccattgctatgctgatggaaaaagaacccgttgaagcttatcat
ttgcaaggccgcagtcatgattgtggtaataaattgggttatatgcaggcattcgtcgaa
tatggtatgaaacataaggacttaggtacagcattcaaggattggatcatgacattgcag
aatcagatcgaaaaataa

DBGET integrated database retrieval system