KEGG   Xenorhabdus bovienii SS-2004: XBJ1_2453Help
Entry
XBJ1_2453         CDS       T01186                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
xbo  Xenorhabdus bovienii SS-2004
Pathway
xbo00010  Glycolysis / Gluconeogenesis
xbo01100  Metabolic pathways
xbo01110  Biosynthesis of secondary metabolites
xbo01120  Microbial metabolism in diverse environments
xbo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xbo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XBJ1_2453
Enzymes [BR:xbo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     XBJ1_2453
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: CBJ81577
UniProt: D3V1N3
Position
2428964..2429836
Genome map
AA seq 290 aa AA seqDB search
MLDKIFSLPIVEQISPYISQRNIEGFPLIVLSHPKVRGAISIQGAHLITWQPSGEKPVLW
LSDNTEFNTGTAIRGGIPICWPWFGSTSAPSHGFARILPWEFRAHHENENGVILTFTLQD
NAETHKLWPHEFTLIARFKLGETCEIELESHGEYQTTCALHSYFNISDVNQIRVSGLGAH
FIDTVADKKQYVHQDLTFKGRIDRIYTEPEDFSLLSDTPWKRTIEIHHYHHSDVVCWNPG
AELSSSMKDMSKEGYKNMVCIETACINSPQLSRNNNPARLSVVIRCRKNP
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcttgataaaattttctcattaccgattgtagaacaaatatctccttatattagccag
cgaaatattgaaggatttccgttgattgttctgtcacacccaaaagtacgcggcgcaatc
agtattcagggggcacatcttattacatggcagcccagtggtgaaaaacctgtattatgg
ttaagcgataacactgaatttaatacaggtacagccattcgtggtggcattcccatctgt
tggccctggtttggttcgacaagcgctcccagtcacggttttgcacggatcttaccttgg
gaattcagggcacaccatgaaaatgaaaacggcgtgatcttgacatttacactacaagat
aatgccgagacacataagttatggccgcacgagttcacactcattgcccgttttaagtta
ggggaaacctgcgaaatagagctggagtctcacggagaatatcaaacaacatgtgctctc
cactcttactttaatatcagtgatgtcaatcaaatccgtgtcagcgggcttggtgctcac
tttatcgataccgttgccgataaaaaacagtacgttcaccaagatctgacttttaaagga
cgaattgaccgcatttatactgaaccagaagatttcagtctactcagtgatacaccgtgg
aaacgaactattgaaattcaccattatcaccatagtgatgtagtttgctggaatcccggt
gccgaactttccagcagtatgaaagatatgagtaaagaaggttacaagaatatggtttgc
atcgaaactgcatgtatcaactccccacaactatccagaaataacaaccctgccaggctt
tctgtggttatccgttgccgtaaaaatccttga

DBGET integrated database retrieval system