KEGG   Xenorhabdus bovienii: XBJ1_2595Help
Entry
XBJ1_2595         CDS       T01186                                 

Gene name
dapE
Definition
N-succinyl-diaminopimelate deacylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
xbo  Xenorhabdus bovienii
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:xbo01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:xbo00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2570264..2571391
Genome map
AA seq 375 aa AA seqDB search
MICPVIELAQQLIKHPSVSPDDQGCQDILIQRLQDTGFTIERMPFGDTLNFWAYHGTGTT
FAFAGHTDVVPAGDTSEWQTPPFDPVIRDGMLYGRGAADMKGSLAAMIVAAERFVKDNPD
HPGRLAFLITSDEEASATNGTVKVVETLMSRHERLDYCLVGEPSSQQRLGDIIKNGRRGS
LTASLTIHGIQGHVAYPQLADNPIHHSLPFLQELVNTQWDNGNEFFPATSMQIANIQAGT
GSNNVIPGKLWVQFNFRFSTELTDTEIRQRVEDMLKKHNLKYDIDWWLSGQPFLTCKGEL
VDAVVESIEQCCGYKPEISMSGGTSDGRFIAKMGAQVVELGPINATIHKVNEGISVSDLQ
KLSLIYQRIMEQLIK
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgatttgcccagtaattgaacttgcccagcagctaatcaaacatccttctgtcagccct
gatgaccaaggatgtcaggatatactcattcaacgtctgcaagatactggttttacaata
gaacgaatgcctttcggggataccctgaatttctgggcttatcacggaacaggcacaacg
tttgctttcgcaggacacactgacgtcgttcctgccggcgatacttctgagtggcaaacc
cctccttttgatcccgttattcgtgatggcatgctgtatggccgtggggcagcggatatg
aaaggttctctggcggccatgattgttgctgctgaacgttttgtcaaagataatcctgac
catccgggccgcctcgctttcctgattacttcagatgaagaagccagcgcgacaaatggc
accgtcaaggtggtcgaaactttaatgtcacgccatgaacgcctggattactgtctggta
ggagaaccttccagccagcaacgtctgggtgacataattaaaaatgggcgtcgtggttcc
ctgacagccagtctgactatccacggtattcaagggcatgttgcctatccacagctggca
gataaccctattcaccattcactgccttttctacaagaactagtcaatacccaatgggac
aatggcaatgaatttttccccgccaccagtatgcaaatcgccaatattcaagcgggaacc
ggcagcaataacgtcataccgggtaaattgtgggttcaatttaatttccgtttcagtact
gaattgacagataccgaaatccgccagcgggttgaagatatgctgaaaaaacataatctg
aaatatgacattgactggtggctatccggccagccttttttgacctgcaaaggtgaactg
gtcgatgccgtggttgaatccattgaacagtgttgcggatataaaccagagatatcaatg
agtggcggcacatcggatgggcgttttattgctaaaatgggagcgcaggttgtggaatta
gggcctattaacgccactatccataaagttaatgaaggtatcagcgtgtcagatttacag
aaattgagcctgatttaccaacgtatcatggagcaattaatcaaatga

DBGET integrated database retrieval system