KEGG   Xenorhabdus bovienii SS-2004: XBJ1_2992Help
Entry
XBJ1_2992         CDS       T01186                                 

Gene name
fadJ
Definition
(GenBank) bifunctional anaerobic fatty acid oxidation complex protein: enoyl-CoA hydratase/epimerase/isomerase (N-terminal); 3-hydroxyacyl-CoA dehydrogenase (C-terminal)
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
xbo  Xenorhabdus bovienii SS-2004
Pathway
xbo00071  Fatty acid degradation
xbo00280  Valine, leucine and isoleucine degradation
xbo00281  Geraniol degradation
xbo00310  Lysine degradation
xbo00362  Benzoate degradation
xbo00380  Tryptophan metabolism
xbo00410  beta-Alanine metabolism
xbo00640  Propanoate metabolism
xbo00650  Butanoate metabolism
xbo00903  Limonene and pinene degradation
xbo00930  Caprolactam degradation
xbo01040  Biosynthesis of unsaturated fatty acids
xbo01100  Metabolic pathways
xbo01110  Biosynthesis of secondary metabolites
xbo01120  Microbial metabolism in diverse environments
xbo01130  Biosynthesis of antibiotics
xbo01200  Carbon metabolism
xbo01212  Fatty acid metabolism
Module
xbo_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:xbo00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    XBJ1_2992 (fadJ)
   00650 Butanoate metabolism
    XBJ1_2992 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    XBJ1_2992 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    XBJ1_2992 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XBJ1_2992 (fadJ)
   00310 Lysine degradation
    XBJ1_2992 (fadJ)
   00380 Tryptophan metabolism
    XBJ1_2992 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    XBJ1_2992 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    XBJ1_2992 (fadJ)
   00281 Geraniol degradation
    XBJ1_2992 (fadJ)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    XBJ1_2992 (fadJ)
   00930 Caprolactam degradation
    XBJ1_2992 (fadJ)
Enzymes [BR:xbo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     XBJ1_2992 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     XBJ1_2992 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     XBJ1_2992 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: CBJ82116
UniProt: D3V8F4
Position
complement(2953426..2955603)
Genome map
AA seq 725 aa AA seqDB search
MAQGEKETIMSETQPKQSVFNFSVRDDKVGVITIDVPGEKVNTLKAEFVEQFLTVFEKAQ
QASGLKGLVIVSGKPDTFIAGADITMIAGCQTEEDATELAEKGQRLFAQIANYPLPVVAA
IHGACLGGGLELALACHIRVCSLDDKTRLGLPEVQLGLLPGSGGTQRLPRLIGVSAALDI
ILTGRQLKAKQAQRLGVVDDAVPLDILLDVAVQYVKKGTPKRKPLAWSQRILASALGRPL
LFHMVHQKTRAKTHGHYPAPELIINVVRTGLEKGLKKGFQAEAKAFGELAMSPESAALRS
LFFASTSLKNETGSSEQPAEIKSVGILGGGLMGGGIANVTMTRGNLPVRIKDINQNGINQ
ALKYTWDILSKRVKQRRLKSSDRSRQMALISGTTDYSGFRQVDIVVEAVFEDLALKRKMV
AEVEEHSKPETIFASNTSSLPICQIAEIASRPEKVIGLHYFSPVDKMPLVEVIPHTGTNE
KTIATAVALAKKQGKTAIVVGDKAGFYVNRILSPYINEAGYCLAEGEPIDHIDKALVDFG
FPIGPINLLDEVGIDVGTKIIPILVAQLGSRFTAPGFLDAVLKDNRKGKKNGRGFYSYGA
KKSKFWPFGNKTKEVDVSIYSLLKIKPHAKMQPSDIAQRCMMLMLNEAVRCLDEGIIRSP
RDGDIGAVFGIGFPPFLGGPFRYIDRLGSDKVVAILHRLEQQYGERFTPCEYLVQMAEQK
KKFYK
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atggctcagggcgaaaaagaaaccattatgtcagagacacaaccgaagcaatcggtattc
aatttttcggtcagagatgacaaggttggtgtgattactattgatgtaccaggtgaaaaa
gtaaacacactgaaagctgaatttgttgagcaatttctgacagtctttgagaaggcacaa
caggcttccggcttgaaagggttggtaatcgtgtctggtaagcctgatacttttatcgct
ggtgccgacatcacgatgatagcaggctgccaaaccgaagaagatgcgacggaactggct
gaaaaaggtcagagattatttgctcagattgccaattatcctttacctgtagttgccgcc
attcacggtgcgtgtttggggggagggctggagctggccttggcctgtcatatacgtgtc
tgttctctggatgataaaactcgtcttggtttgccggaggttcagcttggattattgccg
ggctctggaggaactcagcgattacctcgcctgataggtgtcagcgcagcactggacata
atattgactggccgacagctcaaggctaagcaggcacagcgtctgggtgtggtggatgat
gcagttcccttggatattttgctggatgtggctgttcagtatgttaagaaaggcaccccc
aagcgtaagccattggcatggtctcagcgtattttggcgagcgctctgggcaggccattg
ttgttccatatggttcatcaaaaaacgcgtgcgaaaacccatgggcattatcctgcacca
gagctgattattaatgtcgttcgcacaggattggaaaaggggcttaaaaaaggctttcag
gcagaagccaaggcgtttggtgaactggcaatgtcaccggaatcggcagccttacgcagc
ttattttttgcctcaacgtcgctaaaaaatgaaaccggctcgtcggaacagcctgccgag
atcaagtctgtgggaattttgggtggcggtttgatggggggcggtattgccaacgtgacc
atgacacgcgggaatttgcctgttcgtatcaaagacatcaatcagaacggcatcaatcag
gctttgaaatatacctgggatatcctttccaagcgagtaaaacagcgtcgtttgaaatca
agcgatcgttctcgccagatggctttgatttcgggaaccacagattacagtggcttcagg
caggtcgatattgtggttgaagccgtatttgaagatttggcgctgaaacgaaaaatggtt
gcagaagttgaagaacattcgaaacctgaaactatttttgcttcgaatacttcatcgttg
ccaatttgccagatcgctgaaatagcctctcgaccagagaaagtgattggcctccactat
ttcagtcccgttgataaaatgccattggtggaagttattccacatacgggaacaaatgaa
aaaacgattgccaccgcagtcgcactagccaaaaaacagggaaaaacggctattgtcgtg
ggtgataaagccgggttctatgttaaccggattttgtccccttacattaatgaagcgggt
tattgtctggcggaaggtgaaccgatcgatcatatcgataaggcactggtagattttggt
ttcccgattgggcccattaatttgctggatgaagtcggcattgatgttggtacaaaaatt
attcctattctggtggcgcaattggggagcagatttaccgcaccgggcttcttggatgca
gttttaaaagataaccgaaaaggtaaaaagaatggccgtggtttctattcatatggcgct
aaaaagagcaaattctggccttttggtaacaaaaccaaagaggtggatgtctcgatttat
tccctgttaaaaattaagccacatgcaaaaatgcaaccatcagacattgcccagcgttgc
atgatgctcatgttgaatgaagcagttcgctgtttagatgaaggtattatcagaagcccc
cgtgatggtgatattggtgcggtatttggcatcggtttccctccattcctgggggggcca
ttccgttatatcgataggcttggcagcgataaagttgtggcaattttacatcgtctggaa
cagcagtacggagagagatttacgccctgtgagtatttagttcagatggctgaacagaaa
aagaaattctacaaataa

DBGET integrated database retrieval system