KEGG   Xenorhabdus bovienii: XBJ1_3424Help
Entry
XBJ1_3424         CDS       T01186                                 

Gene name
dsbC
Definition
protein disulfide isomerase II (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
xbo  Xenorhabdus bovienii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3329599..3330300)
Genome map
AA seq 233 aa AA seqDB search
MKKLAFCFSLLLTAFAGNVFANDSAVNNSLVKMGLKAESIKPSQLAGVSTVLTDQGIIHI
SNDGKYLFKGQVYDISGKIPKNVTNQVLVKKLDALKNQMIVYKAPKEKYVVTVFTDITCG
YCRKLHEEMKEYNDLGITIRYLAFPRHSLQHQSAKDMQSIWCSATPNKALDAAFKGDNIS
PIKSCKNDIAKQYQLGLQFGVQGTPAIVLQDGSVLGGFVPPKALKEDLEQQSE
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattagcattttgtttttccttattattgacggcctttgccggcaatgtattt
gctaatgacagtgcggttaataactcattggtaaaaatgggacttaaagccgaaagtatc
aagccatcacaactggctggcgtgagcacggttttgacagatcagggtattatccatatc
tccaacgatggtaagtatttgttcaaaggccaggtttacgatattagtggcaaaatacca
aagaatgtcaccaatcaggttctggtgaaaaaactggatgctttgaaaaatcaaatgatt
gtttacaaagcaccgaaagagaaatatgtcgtgactgtttttactgatattacctgtggt
tattgccgcaagttgcatgaggaaatgaaagagtataacgatttgggtatcaccatccgt
tatttggcatttcctcgccatagtctgcaacatcagtcagccaaagatatgcaatccatc
tggtgcagtgcgacaccgaataaagcgctggatgccgctttcaaaggggataacatttct
ccgatcaaaagctgtaaaaatgatatcgcgaaacaataccagttaggcttgcagtttggt
gttcagggaacacctgcgattgtacttcaggatggcagtgtgcttggtggttttgtgccg
ccaaaagcgctgaaagaagatttggaacaacagagtgaataa

DBGET integrated database retrieval system