KEGG   Xenorhabdus bovienii SS-2004: XBJ1_3454Help
Entry
XBJ1_3454         CDS       T01186                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase, dihydrolipoyltransacetylase subunit
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
xbo  Xenorhabdus bovienii SS-2004
Pathway
xbo00010  Glycolysis / Gluconeogenesis
xbo00020  Citrate cycle (TCA cycle)
xbo00620  Pyruvate metabolism
xbo01100  Metabolic pathways
xbo01110  Biosynthesis of secondary metabolites
xbo01120  Microbial metabolism in diverse environments
xbo01130  Biosynthesis of antibiotics
xbo01200  Carbon metabolism
Module
xbo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:xbo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XBJ1_3454 (aceF)
   00020 Citrate cycle (TCA cycle)
    XBJ1_3454 (aceF)
   00620 Pyruvate metabolism
    XBJ1_3454 (aceF)
Enzymes [BR:xbo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     XBJ1_3454 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 NQRA HlyD_3
Motif
Other DBs
NCBI-ProteinID: CBJ82572
UniProt: D3V4J3
Position
complement(3358852..3360702)
Genome map
AA seq 616 aa AA seqDB search
MSIEINVPDIGADEVEVTEILVKAGDTVEAEQSLITVEGDKASMEVPSPQAGVVKEIKVA
VGDKIETGKLIMIFESAKGAAEAAPVQQKAAASAAAESKVVNVPDIGGDEVEVTEIMVKV
GDTITEEQSLITVEGDKASMEVPAPFAGTVKEIKIAAGDKVKTGSLIMVFEVAGSGAAPA
AAPAPVAAAPAASAAKEVNVPDIGGDEVEVTEIMVKVGDTITEEQSLITVEGDKASMEVP
APFAGTVKEIKIAVGDKVKTGSLIMVFEVVGAAPAVALAAAPSLAVESVKAAPAASQPAE
GKNEFAENDAYVHATPVIRRLAREFGVNLAKVKGTGRKGRILREDIQAYVKDAIKRAEAA
PTAAAGGGMPGMLPWPKIDFSKFGEIEEVEMSRIQKISGANLSRNWVMIPHVNLFDEADI
TEVEEFRKQQNKEAEKKQLGVKITPLVFVMKAAAKALEAMPRFNSSISEDGQKLILKKYI
NIGIAVDTPNGLVVPVFKDVNKKGIMELSRELAEVSKKARAGKLTASDMQGGCFTISSLG
GIGTTGFAPIVNAPEVAIMGLSRSSMKPVWNGKEFVPRLILPMSLSFDHRVIDGADGARF
ITYINEVMSDIRRLAM
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgtctattgaaattaacgtacctgatatcggtgctgatgaagttgaagttaccgagatt
ctggtgaaagcgggtgacaccgtagaagcagagcagtcactgatcactgttgaaggtgac
aaggcttccatggaagtcccatcaccacaggccggtgtggttaaagaaatcaaagttgca
gttggtgacaaaattgaaaccggcaaactgatcatgattttcgagtccgcaaaaggtgca
gcagaagctgcgcctgtgcagcagaaagcagcagcatctgcggcggctgaaagcaaagta
gtcaacgtacctgacatcggtggcgatgaagttgaagtgaccgaaatcatggtaaaagtc
ggtgacactatcactgaagaacagtctctgatcactgtagaaggcgacaaggcttctatg
gaagttccggctccattcgcgggtactgtgaaagaaatcaagattgcggctggcgataaa
gtcaaaacgggttctctgatcatggtattcgaagttgcaggttctggcgcagcgccagca
gcagctccggctccggtagcagcggctcctgcggcatcagcagcaaaagaagtcaacgta
cctgacatcggtggcgatgaagttgaagtgaccgaaatcatggtaaaagtcggtgacacc
atcactgaagagcagtccctgatcaccgttgaaggtgacaaagcttcaatggaagtccct
gctccatttgcgggtactgtgaaagaaatcaagattgccgttggcgacaaagtcaaaacg
ggttctttgattatggtattcgaagtggtgggcgcagctcctgctgtagcactggcagcg
gcaccatctcttgcggttgaatcggtaaaagcagctccagctgcaagtcagccagcagaa
ggtaagaacgaattcgcagaaaatgacgcttacgtccatgcgactcccgtcattcgtcgt
ctggcgcgtgaatttggtgtgaatctggcgaaagtgaaaggaacaggtcgcaaaggccgt
attctgcgcgaagacattcaggcttacgtaaaagatgcgattaaacgcgcagaagcggct
cctactgctgctgcgggtggtggcatgccaggtatgctgccttggccgaaaattgatttc
agcaagtttggtgaaatcgaagaagttgaaatgagccgcatccagaaaatttccggtgct
aatctgagccgtaactgggtcatgatccctcatgttaacttgttcgatgaagcggatatc
actgaagttgaagagttccgtaaacagcagaacaaagaagctgagaagaaacagctgggc
gtgaagatcactccgctcgtattcgtgatgaaagcggctgcgaaagcactggaagcgatg
cctcgttttaacagctctatctctgaagatggccagaagctgatcctgaaaaaatacatc
aacatcggtatcgcggttgatacacctaatggtctggttgttcctgtgttcaaagatgtc
aataagaaaggcatcatggaactgtcaagagaactggctgaagtatccaagaaagcgcgt
gctggtaagctgacggcttccgacatgcagggagggtgcttcactatctccagcttaggt
ggtattggtactaccggctttgcacctatcgtgaatgcaccagaagtggcaatcatgggg
ctgtcccgttcttctatgaaacccgtctggaatggcaaggaattcgttcctcgtctgatt
ctgcctatgtctctgtctttcgaccaccgagtgattgatggagcagatggtgcgcgcttt
atcacttatattaatgaagtgatgagcgatatccgccgtctggcgatgtaa

DBGET integrated database retrieval system