KEGG   Xenorhabdus bovienii: XBJ1_3513Help
Entry
XBJ1_3513         CDS       T01186                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
xbo  Xenorhabdus bovienii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:xbo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XBJ1_3513 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XBJ1_3513 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    XBJ1_3513 (thrC)
Enzymes [BR:xbo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     XBJ1_3513 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3421217..3422509)
Genome map
AA seq 430 aa AA seqDB search
MKLYNLKDSSEQVSFSQAVKQGLGRQQGLFFPQDLPEFSRDEIDELLKLDFVSRSQRILS
AFIGDEIPAEQLAARVKNAFAFPAPVTGVEDDIVSLELYHGPTLAFKDFGGRFMAQILTQ
IAGEQPVTILTATSGDTGAAVAHAFYGLDNVQVVILYPEGKISPLQEKLFCTLGGNIHTV
AIKGDFDACQALVKQAFDDEELKRALYLNSANSINISRLLAQICYYFEAVAQIPAEKREQ
LVISVPSGNFGNLTAGLLAKSLGLPVKRFIAATNVNDTVPRYLSEGAWQPHQTVATLSNA
MDVSQPNNWPRIEELFQRKGWSLSELANGVVDDSTTQATMQELAAKGYISEPHAAVAYRV
LRDQLQAGEYGLFLGTAHPAKFKESVEAILSQPLPLPQELAERADLALLSHFLPADFASL
REFLMERAPT
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaaactatataatttaaaagacagcagcgagcaggtcagcttttcacaggcggttaaa
cagggattgggcagacagcaggggctgttttttccgcaggacttacctgaattcagtcgt
gacgaaatcgacgaattattgaaactggattttgtcagccgtagccagcgaattctctcc
gcttttattggtgatgaaattcccgcagaacaattggcggctcgtgtcaaaaatgctttt
gcctttcctgccccggtgacgggcgtcgaagacgatatcgtttcgctggagttgtatcat
ggaccgacactggctttcaaagattttggtggtcgttttatggcgcaaattctcacacaa
atcgcgggagaacagccggttactattttgactgcaacttccggtgataccggagcggcg
gttgctcatgccttctatggcctggacaacgtacaggtggtgatcctctatccagaaggg
aaaatcagcccattgcaggaaaaattgttctgcacactgggagggaatatccacaccgtc
gctatcaagggcgatttcgatgcttgtcaggcgttggtaaagcaggcttttgatgatgaa
gaactgaaacgtgcattgtatctcaattctgccaactcaattaatatcagccgcttattg
gcacaaatctgctactactttgaagctgttgcccagatcccagcagaaaaacgtgaacag
ttggtgatttccgtgccaagtggcaacttcggtaacttgacagcggggttgctggcgaaa
tcgttggggctgccagtaaaacgttttattgctgcgacgaatgtcaatgataccgttccc
cgttatctgtctgaaggagcatggcagccacatcagaccgttgcgactctttcgaacgcg
atggatgtcagccagccaaataactggccgcgcattgaagagttgttccagcgcaaaggc
tggtcactcagtgaattagccaatggtgtggtggatgacagcaccactcaggccacaatg
caagaactggccgccaaaggctatatttccgaaccccatgccgctgttgcctatcgtgta
ctgcgtgatcaattacaggcaggagagtatggtctgttcttgggaacggctcacccggcc
aagttcaaagaaagcgttgaagcgatcctcagccagccgctgccattgccacaggaattg
gcagagcgtgcggatttagctctgttatctcactttctgcctgctgactttgcgagtttg
cgcgaattcttaatggaaagagcgccgacataa

DBGET integrated database retrieval system