KEGG   Xenorhabdus bovienii: XBJ1_3678Help
Entry
XBJ1_3678         CDS       T01186                                 

Gene name
panD
Definition
aspartate 1-decarboxylase (EC:4.1.1.11)
Orthology
K01579  
aspartate 1-decarboxylase [EC:4.1.1.11]
Organism
xbo  Xenorhabdus bovienii
Pathway
beta-Alanine metabolism
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Brite
KEGG Orthology (KO) [BR:xbo00001]
 Metabolism
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    XBJ1_3678 (panD)
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    XBJ1_3678 (panD)
Enzymes [BR:xbo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.11  aspartate 1-decarboxylase
     XBJ1_3678 (panD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3577192..3577572
Genome map
AA seq 126 aa AA seqDB search
MLRTMLQGKLHRVKVTQADLHYEGSCAIDQNFMDAAGILEYEAIDIYNVDNGERFSTYAI
AAERGSRIISVNGAAARRAAVGDKLIICSYVQIADELTKFHKPKVAYFDGDNVMSRLAKA
VPVQVA
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgttacgcaccatgctacaggggaaactacatcgagtaaaagtgacgcaggccgatctt
cattacgaaggttcctgtgccatcgatcaaaattttatggatgcagccggcattctggaa
tatgaagcgattgatatttataacgttgataatggagaacgattctcaacttatgcaatt
gccgctgaacgtggttccagaatcatctccgtaaacggtgccgcagcacgtcgggcggcg
gtaggcgataagctgattatttgttcatatgtccaaattgctgatgagctgactaaattt
cacaaacccaaagtagcttattttgacggtgataatgtgatgagccggctggcaaaagcg
gttcccgttcaggttgcataa

DBGET integrated database retrieval system