KEGG   Xenorhabdus bovienii: XBJ1_3700Help
Entry
XBJ1_3700         CDS       T01186                                 

Gene name
recD
Definition
exonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
xbo  Xenorhabdus bovienii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:xbo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    XBJ1_3700 (recD)
Enzymes [BR:xbo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     XBJ1_3700 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3603551..3605458
Genome map
AA seq 635 aa AA seqDB search
MSDMKLLLQQAVAQKLLRPLDVQFAYAMIENGDPLLLLITALVSAESGAGHVCLPLERIS
PEYLFEGRQPELAASLWFSAGKPNQQQVISALQACSAVSTGESPAPIILSRHALADYRLY
MQRMWQSERRVAEFFASVELSDDIDEVQLHRILDELFGVTAEGEIDWQKVAAAVAVTSRI
SVISGGPGTGKTTTVAKLLAALIKLNEGRTLSIQLAAPTGKAAARLTESLSEAVNKLALT
SQQSNSIPEQAQTIHRLLGAQPDSQKLRYHRDNPLSLDILIIDEASMVDLPMMARLIEAL
PPRAKVIFLGDKDQLASVEAGAVLGDICRFAEQGYSAKRAEQLSQLTGCQLTSYSMPDSG
EHTLAVRDCLCLLRKSYRFNSASGIGQLASAVNQGNSAGVSAVLGQSLPDVHFNPLAGDE
DYQRLLMQTAEGYYRYLAMVNEQASDKDILAEFNRFRLLCALREGPFGVSGLNQRVEQLL
HRKGVISLPRSAESGGYAGRPIMILRNDSTLGLFNGDIGIMLRNKDNELKAHFQLSDGTI
KPFQPSRLPQHETAYVMTVHKSQGSEFEHTALVLPTQFSPVVSRELVYTALTRAREKLTL
YAHKPVLDKAVSTSTQRRSGLAEWLKPKGECQSGQ
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacatgaaattattgttgcagcaagccgttgcccaaaaattactgcgcccgctg
gatgtgcagtttgcttatgcaatgattgaaaacggagatcctctgttattgctgattacg
gcattggtgagtgcggaatcaggagcagggcatgtctgcctgccattagagcggatctcg
cctgaatatttatttgaggggcggcagcctgaattagcagcatcgctctggttttcggcg
gggaaaccaaatcagcagcaagttatttcagcgttacaagcatgttctgcagtgagcact
ggcgaatctcccgcaccgatcattctttcccgccacgctcttgctgattatcgcctttac
atgcaacgcatgtggcaaagtgagcgtcgggtcgcggagttttttgcgtcggtagaatta
tctgacgatattgatgaagtgcaattacatcgcattttggatgaactttttggtgtcacc
gctgaaggggaaatagactggcagaaagtggcggcggcagttgctgtaaccagccgtatt
tccgttatctctggcgggccagggacaggaaaaacgacgacggtagctaagttgctggcc
gccttgatcaaactgaatgaaggcagaacactgagtattcaattggccgcacccactggt
aaagcggccgccagattgactgaatcgctgagtgaggcagtcaataaactggctttaaca
tcacaacaatcgaatagcattcctgagcaggcacaaacaattcatcgcctgttgggagcg
cagccagatagccagaaactgcgttatcaccgcgataatccgctatctcttgatattttg
atcatcgatgaagcctcaatggtggacttaccgatgatggcacgtttgatagaagccctg
ccaccacgggcaaaagtgatttttctgggggataaagatcagttggcctcggttgaagcg
ggagccgtattgggggacatctgccgcttcgctgaacaaggttatagtgccaagcgtgcc
gaacaattgagtcagttgacaggctgtcagctaacatcgtattcaatgcctgattctgga
gaacatacactggcagtccgggattgcttatgtctgttacgtaaaagctatcgtttcaac
tcggcttcgggtatcgggcaattagcatcggcggttaatcaaggcaatagtgccggggta
tctgccgtcttgggtcagtctttgcctgatgttcacttcaatcctcttgcaggagatgaa
gattatcagcgtttattgatgcaaactgcagaaggttattaccgttatttagcgatggtg
aacgaacaagcatctgacaaagacattttggcagagtttaaccgtttcaggttgttgtgt
gctttgagggaagggccgtttggtgtaagcggcttgaaccagcgggtagagcaattgtta
catcgtaaaggcgttatttctctgcccagaagtgcggagagcgggggttatgccggacgt
cccattatgatcttacgcaacgatagtacactggggctatttaatggtgacattggtatt
atgctcaggaataaggataatgagctgaaagcccattttcagctatctgatgggacgata
aagccatttcagccgagccgattgcctcagcatgaaacggcctatgtgatgactgtccat
aaatcccaaggttctgagtttgaacacaccgcgttagtcttgccgactcaattctcgcca
gttgtcagccgggaactggtgtacacagccttaacccgtgcccgtgaaaaattgacgctt
tacgcacataaaccggttctggataaggcggtgagtacatcaacacagcggcgtagtggc
ttggcagaatggctcaagccaaagggagagtgtcaatcaggtcagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system